Use Able AI chat for product recommendations

ADAM17 Monoclonal antibody, PBS Only (Detector)

ADAM17 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 68725-1-PBS
Clone No. 2F4C2
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

Snake venom-like protease, EC:3.4.24.86, Disintegrin and metalloproteinase domain-containing protein 17, cSVP, ADAM 17

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ADAM17 in ?

Product Information

68725-1-PBS targets ADAM17 as part of a matched antibody pair:

MP50392-2: 68725-2-PBS capture and 68725-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag34022

Product name: Recombinant human ADAM17 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 693-824 aa of BC136783

Sequence: CVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC

Predict reactive species
Full Name ADAM metallopeptidase domain 17
Calculated Molecular Weight 824 aa, 93 kDa
Observed Molecular Weight 90-110 kDa
GenBank Accession NumberBC136783
Gene Symbol ADAM17
Gene ID (NCBI) 6868
RRIDAB_3670417
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP78536
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The ADAMs (A Disintegrin And Metalloprotease) are multidomain transmembrane proteins. One of the first ADAMs implicated in membrane shedding is ADAM-17, which is shown to release the active form of tumor necrosis factor (TNF)-a from its precursor (PMID:18238782). ADAM17 is also named as CSVP, TACE. The full length protein has 9 glycosylation sites, a signal peptide, propeptide and 2 isoforms produced by alternative splicing.The 120-kDa form of ADAM-17 is expressed more frequently and at higher levels in primary breast carcinomas compared with normal breast tissue(PMID:17438092).

Loading...
||
New chat

Able™

正在加载,请稍候...