Collagen Type III Monoclonal antibody

Collagen Type III Monoclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 68320-1-Ig
Clone No.3B1F3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, ELISA

COL3, COL3A1, 3B1F3, Collagen alpha 1(III) chain, Collagen alpha-1(III) chain

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig colon tissue, human placenta tissue, human rectum tissue, rabbit large intestine tissue, rat colon tissue
Positive IHC detected inhuman ovary tumor tissue, human hepatocirrhosis tissue, human placenta tissue, mouse skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman colon cancer tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68320-1-Ig targets Collagen Type III in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4229

Product name: Recombinant human COL3A1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1150-1466 aa of BC028178

Sequence: DGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSSAEKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL

Predict reactive species
Full Name collagen, type III, alpha 1
Calculated Molecular Weight 1466 aa, 139 kDa
Observed Molecular Weight130 kDa
GenBank Accession NumberBC028178
Gene Symbol COL3A1
Gene ID (NCBI) 1281
RRIDAB_2935393
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP02461
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Type III collagen is a fibrillar-forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome type IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341).

Protocols

Product Specific Protocols
IF protocol for Collagen Type III antibody 68320-1-IgDownload protocol
IHC protocol for Collagen Type III antibody 68320-1-IgDownload protocol
WB protocol for Collagen Type III antibody 68320-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Int J Mol Med

SPP1 promotes the polarization of M2 macrophages through the Jak2/Stat3 signaling pathway and accelerates the progression of idiopathic pulmonary fibrosis

Authors - Xuelian Yang
humanIF

J Nanobiotechnology

Melt-electrowriting-enabled anisotropic scaffolds loaded with valve interstitial cells for heart valve tissue Engineering

Authors - Chao Xu
humanIHC

Int Immunopharmacol

RACGAP1 is a pivotal gene in lung adenocarcinoma-associated membranous nephropathy: Based on comprehensive bioinformatics analysis and machine learning

Authors - Qianqian Xu
humanWB

Mater Today Bio

Silk fibroin microgrooved zirconia surfaces improve connective tissue sealing through mediating glycolysis of fibroblasts

Authors - Yinuo Yan
humanWB

Int J Mol Sci

A Positive Feedback Loop Exists between Estradiol and IL-6 and Contributes to Dermal Fibrosis

Authors - DeAnna Baker Frost
mouseWB

Front Med (Lausanne)

Efficacy and safety of pseudolaric acid B against Echinococcus multilocularis in vitro and in a murine infection model

Authors - Zhuo-Ma Dawa
Loading...
||
New chat Able
正在加载,请稍候...