Cytokeratin 7 Monoclonal antibody

Cytokeratin 7 Monoclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 68296-1-Ig
Clone No.3G2H1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF-P, ELISA

KRT7, 3G2H1, CK 7, CK7, CK-7

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inEC109 cells, HeLa cells, HaCat cells, A431 cells, A549 cells, BxPC-3 cells, T-47D cells
Positive IHC detected inhuman lung cancer tissue, human endometrial cancer tissue, human ovary tumor tissue, human pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:4150-1:16600
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68296-1-Ig targets Cytokeratin 7 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7895

Product name: Recombinant human CK7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC002700

Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDAR

Predict reactive species
Full Name keratin 7
Calculated Molecular Weight 469 aa, 51 kDa
Observed Molecular Weight51 kDa
GenBank Accession NumberBC002700
Gene Symbol Cytokeratin 7
Gene ID (NCBI) 3855
RRIDAB_2935376
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08729
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. KRT7, also named cytokeratin 7, is one member of type II basic cytokeratin. It is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels, and their neoplasms. KRT7 is a marker of epithelial tissues, but not present in carcinomas of stratified squamous cell origin.

Protocols

Product Specific Protocols
IF protocol for Cytokeratin 7 antibody 68296-1-IgDownload protocol
IHC protocol for Cytokeratin 7 antibody 68296-1-IgDownload protocol
WB protocol for Cytokeratin 7 antibody 68296-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...