Product Information
60759-2-PBS targets Midkine as part of a matched antibody pair:
MP51205-1: 60759-1-PBS capture and 60759-2-PBS detection (validated in Cytometric bead array)
MP51205-2: 60759-3-PBS capture and 60759-2-PBS detection (validated in Cytometric bead array)
MP51205-3: 60759-4-PBS capture and 60759-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG3 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag33793 Product name: Recombinant human MDK protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 79-143 aa of BC011704 Sequence: EFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD Predict reactive species |
Full Name | midkine (neurite growth-promoting factor 2) |
Calculated Molecular Weight | 16 kDa |
GenBank Accession Number | BC011704 |
Gene Symbol | Midkine |
Gene ID (NCBI) | 4192 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A Magarose purification |
UNIPROT ID | P21741 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |