Product Information
60668-1-PBS targets IGF2 as part of a matched antibody pair:
MP50953-1: 60668-1-PBS capture and 60668-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21397 Product name: Recombinant human IGF2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 75-180 aa of BC000531 Sequence: CDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK Predict reactive species |
| Full Name | insulin-like growth factor 2 (somatomedin A) |
| Calculated Molecular Weight | 236 aa, 26 kDa |
| GenBank Accession Number | BC000531 |
| Gene Symbol | IGF2 |
| Gene ID (NCBI) | 3481 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P01344 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

