Filter:
Tested Applications
| Positive WB detected in | A549 cells, HepG2 cells |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30963-1-AP targets AGTR2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33887 Product name: Recombinant human AGTR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-45 aa of NM_000686 Sequence: MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD Predict reactive species |
| Full Name | angiotensin II receptor, type 2 |
| Calculated Molecular Weight | 41 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | NM_000686 |
| Gene Symbol | AGTR2 |
| Gene ID (NCBI) | 186 |
| RRID | AB_3669797 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P50052 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AGTR2 (angiotensin II type 2 receptor) is part of the renin-angiotensin signaling (RAS) pathway that has been widely studied for its role in blood pressure regulation and renal and cardiovascular health (PMID: 29937318). AGTR2 mediates the effects of angiotensin II on cellular differentiation and growth (PMID: 30455538).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AGTR2 antibody 30963-1-AP | Download protocol |
| WB protocol for AGTR2 antibody 30963-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
