Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, RAW 264.7 cells, mouse heart tissue, SH-SY5Y cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human colon cancer tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SH-SY5Y cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 17 publications below |
| IHC | See 1 publications below |
| IF | See 4 publications below |
Product Information
13422-1-AP targets PPP3CA in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, pig, monkey, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4203 Product name: Recombinant human PPP3CA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 3-302 aa of BC025714 Sequence: EPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSL Predict reactive species |
| Full Name | protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform |
| Calculated Molecular Weight | 59 kDa |
| Observed Molecular Weight | 59 kDa |
| GenBank Accession Number | BC025714 |
| Gene Symbol | PPP3CA |
| Gene ID (NCBI) | 5530 |
| RRID | AB_2168314 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q08209 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PPP3CA, also called calcineurin Aα, is the only serine/threonine protein phosphatase under the control of Ca2+/calmodulin, and plays a critical role in the coupling of Ca2+ signals to cellular responses. Ca2+ signaling plays a central role in hypertrophic growth of cardiac and skeletal muscle in response to mechanical load and a variety of signals. Therefore, PPP3CA plays an important role in muscle differentiation, especially in muscle fiber type conversion. It is also involved in osteoclast regulation, regulating bone formation through an effect on osteoblast differentiation.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for PPP3CA antibody 13422-1-AP | Download protocol |
| IF protocol for PPP3CA antibody 13422-1-AP | Download protocol |
| IHC protocol for PPP3CA antibody 13422-1-AP | Download protocol |
| IP protocol for PPP3CA antibody 13422-1-AP | Download protocol |
| WB protocol for PPP3CA antibody 13422-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Psychiatry A recurrent SHANK1 mutation implicated in autism spectrum disorder causes autistic-like core behaviors in mice via downregulation of mGluR1-IP3R1-calcium signaling. | ||
J Adv Res Transducin-like enhancer of split 3 protects against lipopolysaccharide-induced inflammation through DDX5-ATF1-PPP2R5A signaling | ||
Proc Natl Acad Sci U S A Major contribution of the 3/6/7 class of TRPC channels to myocardial ischemia/reperfusion and cellular hypoxia/reoxygenation injuries. | ||
J Agric Food Chem Dietary Taurine Supplementation Improves the Meat Quality, Muscle Fiber Type, and Mitochondrial Function of Finishing Pigs | ||
J Cell Physiol Taurine promotes muscle fiber type transformation through CaN/NFATc1 signaling in porcine myoblasts | ||
Neurobiol Dis Calcineurin β protects brain after injury by activating the unfolded protein response. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH nuo (Verified Customer) (08-22-2021) | A very good ab to probe PPP3CA by WB. With a high titer.
![]() |
























