IL-10 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• IL-10 Monoclonal antibody (60269-1-Ig)

• Featured Product
• KD/KO Validated

IL-10 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 60269-1-Ig Copied!

Clone No. 8E4B6

Publications (220)

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (5)

Applications

WB, IHC, IF/ICC, ELISA, Cell treatment

Synonyms

IL-10,IL10, 8E4B6, CSIF, IL 10, IL10

• 

  WB analysis of Recombinant protein using 60269-1-Ig

  Recombinant protein were subjected to SDS PAGE followed by western blot with 60269-1-Ig (IL-10 antibody at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 60269-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 60269-1-Ig (IL-10 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MOLT-4 using 60269-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed MOLT-4 cells using IL-10 antibody (60269-1-Ig, Clone: 8E4B6 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IL-10 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: ag14870
• Positive IF/ICC detected in: MOLT-4 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60269-1-Ig targets IL-10 in WB, IHC, IF/ICC, ELISA, Cell treatment applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat, pig, rabbit, monkey, zebrafish
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14870

  Product name: Recombinant human IL-10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 19-178 aa of BC104252

  Sequence: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

• Full Name: interleukin 10
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC104252
• Gene Symbol: IL-10
• Gene ID (NCBI): 3586
• RRID: AB_2881389
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P22301
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin (IL)-10 is an anti-inflammatory cytokine, produced by T helper (Th) cells, macrophages, monocytes, and B cells, that plays a crucial role in preventing inflammatory and autoimmune pathologies. It downregulates the expression of Th1 cytokines, MHC class II antigens, and co-stimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. IL-10 can block NF-κB activity, and is involved in the regulation of the JAK-STAT signaling pathway. IL-10, along with its receptors, describes an important role in pathogenesis of various diseases, including infectious, inflammatory, autoimmune diseases. IL-10 mutations are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis.

Publications

What published studies show

The anti-IL-10 mouse monoclonal antibody (Cat# 60269-1-Ig) has 220 total citations published in high-impact journals including Immunity, Signal Transduction and Targeted Therapy, Advanced Science, ACS Nano, Materials Today Bio, International Immunopharmacology, and Frontiers in Immunology. Key research fields include macrophage polarization, wound healing, bone regeneration, tumor immunology, neuroinflammation, cardiovascular disease, diabetic complications, fibrosis, and infectious diseases. Common applications are WB, IHC, IF, and ELISA.

Automatically generated from the 220 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Signal Transduct Target Ther; Corynebacterium parakroppenstedtii secretes a novel glycolipid to promote the development of granulomatous lobular mastitis; Authors - Ran Liu
	Cell treatment	Immunity; Expression of the readthrough transcript CiDRE in alveolar macrophages boosts SARS-CoV-2 susceptibility and promotes COVID-19 severity; Authors - Yuichi Mitsui
human	WB	J Natl Cancer Cent; S100A8 promotes tumor progression by inducing phenotypic polarization of microglia through the TLR4/IL-10 signaling pathway in glioma; Authors - Yuechao Yang
rat	IHC	Bioact Mater; Continuously released Zn2+ in 3D-printed PLGA/β-TCP/Zn scaffolds for bone defect repair by improving osteoinductive and anti-inflammatory properties; Authors - Chunxu Li
	IHC	Bioact Mater; A bioactive composite hydrogel dressing that promotes healing of both acute and chronic diabetic skin wounds; Authors - Shunlai Shang
		ACS Nano; Inhalation of Mesenchymal-Stem-Cell-Derived Nanovesicles Delivering Catalase Enhances the Treatment for Acute Lung Injury; Authors - Linna Zhang