Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, mouse kidney tissue, rat kidney tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human liver tissue, mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 97 publications below |
| IHC | See 1 publications below |
| IF | See 22 publications below |
| IP | See 2 publications below |
| CoIP | See 3 publications below |
Product Information
18409-1-AP targets TOMM40 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13065 Product name: Recombinant human TOMM40 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-361 aa of BC017224 Sequence: MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG Predict reactive species |
| Full Name | translocase of outer mitochondrial membrane 40 homolog (yeast) |
| Calculated Molecular Weight | 38 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC017224 |
| Gene Symbol | TOMM40 |
| Gene ID (NCBI) | 10452 |
| RRID | AB_2303725 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O96008 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The translocase of outer mitochondria membrane 40 (TOMM40, also known as TOM40), located in the center of the TOM complex, is a channel-forming subunit of translocase. It can facilitate the fluid movement of preproteins into the mitochondria by associating with TOMM20. TOMM40 plays a role in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by forming a complex with BCAP31 and mediating the translocation of Complex I components from the cytosol to the mitochondria (PMID: 31206022). TOMM40 has been reported to be associated with late-onset neurodegenerative diseases such as Alzheimer's disease and Parkinson's disease.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TOMM40 antibody 18409-1-AP | Download protocol |
| IF protocol for TOMM40 antibody 18409-1-AP | Download protocol |
| IHC protocol for TOMM40 antibody 18409-1-AP | Download protocol |
| IP protocol for TOMM40 antibody 18409-1-AP | Download protocol |
| WB protocol for TOMM40 antibody 18409-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nature In vivo imaging of mitochondrial membrane potential in non-small-cell lung cancer. | ||
Cell Tau interactome maps synaptic and mitochondrial processes associated with neurodegeneration. | ||
Cell Discov The Fe-S cluster assembly protein IscU2 increases α-ketoglutarate catabolism and DNA 5mC to promote tumor growth | ||
Cell Metab Quantitative high-confidence human mitochondrial proteome and its dynamics in cellular context.
| ||
Nat Cell Biol MIROs and DRP1 drive mitochondrial-derived vesicle biogenesis and promote quality control. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Emilie (Verified Customer) (09-24-2025) | I applied it in IF (1:200), and it showed good performance.
|
FH Manon (Verified Customer) (09-17-2025) | We observed clear mitochondrial labeling with this antibody
|
FH Yan (Verified Customer) (10-21-2024) | Very good protein signal in BJ-hTERT cells in IF. I would recommend it to assess mitochondrial morphology.
![]() |
FH Nuo (Verified Customer) (01-28-2023) | Good antibody for WB with high titer.
![]() |
FH Süleyman (Verified Customer) (01-23-2022) | TOMM40 antibody (Green) is used 1:100 dilution (2 hour at RT) and 1:700 of Alexa Fluor 488 secondary antibody (1 hour RT). 4% Paraformaldehyde fixation for 10 min at RT. Permeabilization with 0.3% Triton X for 10-15 minutes at RT. 5% FBS in PBS used for blocking for 1 hour at RT. The image is colocalized with TOMM20 (Red). Blue is DAPI. As you can see there is colocalization with TOMM20 with TOMM40. It is a perfect colocalization. You might also reduce concentration to 1:300 as it was used low power of laser.
![]() |
FH Tom (Verified Customer) (03-23-2021) | Cos7 cells fixed in 4% PFA and permeabilized in 0.1% Triton X-100. Cells blocked in 1% BSA in PBS.
![]() |
FH Daniela (Verified Customer) (01-08-2020) | Immunoblot of total cell lysate of HeLa cell gives three bands, one specific for human Tom40 above 37 KDa on 15% acrylamide gel, the other two no specific and with much lower intensity. The anti-Tom40 antibody worked very well and specifically when conjugated with magnetic beads for immunoprecipitation.
|



























