Recombinant human PTEN protein

Name: Recombinant human PTEN protein
Brand: Proteintech
SKU: Ag17274

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Liquid

Publications

Cat no : Ag17274

Synonyms

10q23del; BZS; MGC11227; MHAM; MMAC1; PTEN1; TEP1

Validation Data Gallery View All

PTEN fusion protein Ag17274 SDS-PAGE

-/ -

Cat No. Ag17274

Freight/Packing: -

Country/Region

Size

Quantity

Please visit your regions distributor:

Request bulk or custom quote

Product Information

Peptide Sequence	PMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITK (204-403 aa encoded by BC005821)
Activity	Not tested.
Endotoxin Level	Please contact the lab for more information.
Formulation	The protein was expressed as GST-tagged fusion protein by E.Coli and purified by Glutathione-sepharose. The purified protein was resolved in PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4 ) added with 15% glycerol. The elution buffer contain 100mM GSH.

Shipping and Storage

Reconstitution	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping	The product is shipped with ice packs. Upon receipt, store it immediately at -20°C to -80°C.
Stability and Storage	Aliquot and store at -20°C to -80°C for up to 6 months. Avoid freeze thaw cycles.
Storage of Reconstituted Protein	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.

Publications

Species	Title
	Cancer Lett Rpn10 promotes tumor progression by regulating hypoxia-inducible factor 1 alpha through the PTEN/Akt signaling pathway in hepatocellular carcinoma. Authors - Zhiyuan Jiang View Article

Recombinant human PTEN protein

Validation Data Gallery View All

PTEN fusion protein Ag17274 SDS-PAGE

Product Information

Shipping and Storage

Publications

Rpn10 promotes tumor progression by regulating hypoxia-inducible factor 1 alpha through the PTEN/Akt signaling pathway in hepatocellular carcinoma.

Related Products

Phospho-PTEN (Thr382/383) Polyclonal antibody

CoraLite® Plus 488-conjugated PTEN Recombinant antibody

CoraLite® Plus 488-conjugated PTEN Monoclonal antibody

CoraLite®594-conjugated PTEN Monoclonal antibody

Phospho-PTEN (Ser380) Recombinant antibody, PBS Only (Capture)

Phospho-PTEN (Ser380) Recombinant antibody, PBS Only (Detector)

PTEN Recombinant antibody, PBS Only (Capture)

PTEN Recombinant antibody, PBS Only (Detector)

PTEN Monoclonal antibody

PTEN Monoclonal antibody, PBS Only

PTEN Monoclonal antibody, PBS Only (Capture)

PTEN Monoclonal antibody, PBS Only (Detector)

PTEN Recombinant antibody, PBS Only (Detector)

PTEN Recombinant antibody, PBS Only (Detector)

PTEN Recombinant antibody, PBS Only (Detector)

PTEN Recombinant antibody, PBS Only (Capture)

PTEN Recombinant antibody, PBS Only (Capture)

PTEN Recombinant antibody, PBS Only

PTEN Recombinant antibody

PTEN Recombinant antibody, PBS Only (Capture)