Recombinant human POLD4 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag23924
Synonyms
POLDS; p12
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
(1-34 aa encoded by BC001334) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
