PAX8 Monoclonal antibody

PAX8 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 60145-4-Ig
Clone No.4H7B3

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, ELISA

PAX-8, 4H7B3, paired box 8, Paired box protein Pax 8, Paired box protein Pax-8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSKOV-3 cells, human thyroid gland tissue
Positive IHC detected inhuman ovary tumor tissue, human ovary cancer tissue, human thyroid cancer tissue, human tonsillitis tissue, mouse kidney tissue, rat kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse kidney tissue
Positive IF/ICC detected inSKOV-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:5000-1:20000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60145-4-Ig targets PAX8 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0306

Product name: Recombinant human PAX8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-212 aa of BC001060

Sequence: MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDS

Predict reactive species
Full Name paired box 8
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 48 kDa
GenBank Accession NumberBC001060
Gene Symbol PAX8
Gene ID (NCBI) 7849
RRIDAB_10643528
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ06710
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PAX8 is a member of the paired box (PAX) family of transcription factors, typically containing a paired box domain and a paired-type homeodomain. It is expressed during organogenesis of the thyroid gland, kidney and Mullerian system. It is thought to regulate the expression of Wilms tumor suppressor (WT1) gene and mutations in PAX8 have been associated with Wilms tumor cells, thyroid and ovarian carcinomas. PAX8 is a useful marker in distinguishing ovarian carcinomas from mammary carcinomas (PMID: 18724243). PAX8 is expressed in a high percentage of ovarian serous, endometrioid, and clear cell carcinomas, but only rarely in primary ovarian mucinous adenocarcinomas.

PAX8 has 5 isoforms with calculated MW 31kd, 34kd, 41kd, 43kd and 48kd. And there is a 60kd band corresponding to the electrophoretic mobility of PAX8 (PMID:15650356).

Protocols

Product Specific Protocols
IF protocol for PAX8 antibody 60145-4-IgDownload protocol
IHC protocol for PAX8 antibody 60145-4-IgDownload protocol
WB protocol for PAX8 antibody 60145-4-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Dev Cell

Identification of a core transcriptional program driving the human renal mesenchymal-to-epithelial transition

Authors - John-Poul Ng-Blichfeldt
humanIHC

Mod Pathol

Xp11.2 translocation renal cell carcinoma with NONO-TFE3 gene fusion: morphology, prognosis, and potential pitfall in detecting TFE3 gene rearrangement.

Authors - Qiu-Yuan Xia
humanIF

Stem Cell Res Ther

Genetic correction of induced pluripotent stem cells from a DFNA36 patient results in morphologic and functional recovery of derived hair cell-like cells

Authors - Yi Luo
mouseIHC,IF

Front Cell Dev Biol

Lgr4 Regulates Oviductal Epithelial Secretion Through the WNT Signaling Pathway

Authors - Xue Tan
humanIHC

Sci Rep

Differential epithelial and stromal LGR5 expression in ovarian carcinogenesis.

Authors - Hyesung Kim
humanIHC

Hum Pathol

Clinicopathological and Molecular Characterization of Biphasic Hyalinizing Psammomatous Renal Cell Carcinoma (BHP RCC): Further Support for the Newly Proposed Entity.

Authors - Xiao-Tong Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kenzo (Verified Customer) (03-28-2024)

It worked well for immunolabeling in mouse retina tissues

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse retina
FH

Juan (Verified Customer) (04-18-2019)

It works well in Western Blot experiment.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HepG2 Cell line
Loading...
||
New chat

Able

正在加载,请稍候...