Recombinant human IL-6 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag10565
Synonyms
IL6, IL-6, B-cell stimulatory factor 2, IFN-beta-2, IL 6
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
(1-212 aa encoded by BC015511) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
