Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, U-937 cells, Raji cells, human white blood, NCCIT cells, pig spleen tissue, Calu-1 cells, HEK-293 cells, Jurkat cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human tonsillitis tissue, human liver cancer tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
| Positive IF/ICC detected in | Raji cells |
| Positive FC detected in | Raji cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:10000 |
| Immunofluorescence (IF)-P | IF-P : 1:400-1:1600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) | FC : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66013-1-Ig targets HLA class I ABC in WB, IHC, IF/ICC, IF-P, FC, IP, ELISA applications and shows reactivity with human, pig samples.
| Tested Reactivity | human, pig |
| Cited Reactivity | human, pig |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7488 Product name: Recombinant human HLA class I (HLA-A) protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 29-302 aa of BC003069 Sequence: MRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSS Predict reactive species |
| Full Name | major histocompatibility complex, class I, A |
| Calculated Molecular Weight | 41 kDa |
| Observed Molecular Weight | 40-44 kDa |
| GenBank Accession Number | BC003069 |
| Gene Symbol | HLA-A |
| Gene ID (NCBI) | 3105 |
| RRID | AB_11042593 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P04439 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). This class I molecules are polymorphic membrane glycoproteins composed of a heavy (alpha) chain (44 kDa) which is encoded by a HLA class I gene (HLA-A, B or C), and β2-microglobulin light (beta) chain (12 kDa). They are involved in the presentation of foreign antigens to the immune system. (PMID: 667938; 3375250)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for HLA class I ABC antibody 66013-1-Ig | Download protocol |
| IF protocol for HLA class I ABC antibody 66013-1-Ig | Download protocol |
| IHC protocol for HLA class I ABC antibody 66013-1-Ig | Download protocol |
| IP protocol for HLA class I ABC antibody 66013-1-Ig | Download protocol |
| WB protocol for HLA class I ABC antibody 66013-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-MHC-I antibody (Cat# 66013-1-Ig) has 23 total citations appearing in journals including Molecular Cancer, Advanced Science, PNAS, Cell Death & Disease, International Journal of Biological Sciences, Cell Reports, Oncotarget, Journal of Biological Chemistry, Frontiers in Medicine, Oncoimmunology, Behavior and Brain Research, Tissue Engineering, Human Immunology, Biotechniques, Laryngoscope, and Heliyon. Research fields span cancer immunology, MHC-I antigen presentation, tissue engineering, xenotransplantation, virology, and neurobiology.
| Species | Application | Title |
|---|---|---|
Mol Cancer IFITM3 enhances immunosensitivity via MHC-I regulation and is associated with the efficacy of anti-PD-1/-L1 therapy in SCLC. | ||
Adv Sci (Weinh) Genetic Ablation and Multi-Omics Profiling Reveal CEP55 as a Key Driver of Tumorigenesis in Diverse Cancer Models. | ||
Adv Sci (Weinh) Engineered Xenogeneic Bone Scaffold with IL-10 Nanodelivery System: Immunomodulation and BMSC Fate Programming for Skull Defect Repair. | ||
Cell Death Dis AZIN1-dependent polyamine synthesis accelerates tumor cell cycle progression and impairs effector T-cell function in osteosarcoma | ||
Int J Biol Sci Prolonged DEHP exposure enhances the stemness and metastatic potential of TNBC cells in an MSI2-dependent manner | ||
Proc Natl Acad Sci U S A ZNF263-NuRD-mediated repression of STAT1 curtails MHC-I antigen presentation and IFN-γ efficacy in prostate cancer |
Reviews
What customers say
The single review for this product is a 5-star rating from a researcher who used it for Western Blot at a 1:1000 dilution. The reviewer described the HLA class I ABC antibody as "very good," indicating satisfaction with its performance in their application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sai Sindhura (Verified Customer) (01-08-2026) | HLA class 1 ABC antibody is very good
|
