Hemoglobin Epsilon Polyclonal antibody

Hemoglobin Epsilon Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 12361-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), ELISA

HBE1, Epsilon globin, Epsilon-globin, HBE, Hemoglobin epsilon chain

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue, K-562 cells, mouse placenta tissue
Positive IHC detected inhuman placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman placenta tissue
Positive FC (Intra) detected inK-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12361-1-AP targets Hemoglobin Epsilon in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3026

Product name: Recombinant human HBE1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-147 aa of BC015537

Sequence: MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKYH

Predict reactive species
Full Name hemoglobin, epsilon 1
Calculated Molecular Weight 147 aa, 16 kDa
Observed Molecular Weight 12-16 kDa
GenBank Accession NumberBC015537
Gene Symbol HBE1
Gene ID (NCBI) 3046
RRIDAB_2114593
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02100
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The hemoglobin molecule is a tetramer consisting of two alpha- and two beta-globin-like chains. HBE1 (hemoglobin epsilon chain) is a beta-type chain of hemoglobin predominantly expressed during the embryonic stage (21321359). The HBE1 has been regarded as the best marker for fetal nucleated red blood cells (NRBCs) . This antibody can be used to label and isolate fetal cells from maternal blood and may be useful in prenatal diagnosis (15906407).

Protocols

Product Specific Protocols
WB protocol for Hemoglobin Epsilon antibody 12361-1-APDownload protocol
IHC protocol for Hemoglobin Epsilon antibody 12361-1-APDownload protocol
IF protocol for Hemoglobin Epsilon antibody 12361-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Blood

NFI-A directs the fate of hematopoietic progenitors to the erythroid or granulocytic lineage and controls beta-globin and G-CSF receptor expression.

Authors - Linda Marie Starnes
humanWB

Cell Death Differ

Transcriptional fine-tuning of microRNA-223 levels directs lineage choice of human hematopoietic progenitors.

Authors - L Vian
humanWB

Mol Cell Biol

A Feedback Loop Consisting of MicroRNA 23a/27a and the β-Like Globin Suppressors KLF3 and SP1 Regulates Globin Gene Expression.

Authors - Ma Yanni Y
humanWB

Biochim Biophys Acta Mol Cell Res

Long noncoding RNA CCDC26 as a modulator of transcriptional switching between fetal and embryonic globins.

Authors - Tetsuo Hirano
ratWB

Proteome Sci

A comparison of E15.5 fetus and newborn rat serum proteomes.

Authors - Wei Lilong L
mouseIHC

Blood

Requirement for antiapoptotic MCL-1 during early erythropoiesis

Authors - Meghan E Turnis
Loading...
||
New chat Able
正在加载,请稍候...