Tested Applications
| Positive WB detected in | mouse testis tissue | 
| Positive IP detected in | mouse testis tissue | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below | 
| WB | See 4 publications below | 
| IF | See 2 publications below | 
Product Information
20183-1-AP targets GABRB1 in WB, IP, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag14070 Product name: Recombinant human GABRB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 330-440 aa of BC022449 Sequence: IFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTSVSDPKATMYSYDSASIQYRKPLSSREAYGRALDRHGVPSKGRNRRRASQLKVKI Predict reactive species | 
                                    
| Full Name | gamma-aminobutyric acid (GABA) A receptor, beta 1 | 
| Calculated Molecular Weight | 474 aa, 54 kDa | 
| Observed Molecular Weight | 50-54 kDa | 
| GenBank Accession Number | BC022449 | 
| Gene Symbol | GABRB1 | 
| Gene ID (NCBI) | 2560 | 
| RRID | AB_10638781 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P18505 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for GABRB1 antibody 20183-1-AP | Download protocol | 
| WB protocol for GABRB1 antibody 20183-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Nat Biotechnol Magnify is a universal molecular anchoring strategy for expansion microscopy | ||
iScience Increased NMDARs in neurons and glutamine synthetase in astrocytes underlying autistic-like behaviors of Gabrb1-/- mice
  | ||
Food Funct Ginsenoside Rg5/Rk1 ameliorated sleep via regulating the GABAergic/serotoninergic signaling pathway in a rodent model. | ||
Reprod Fertil Dev Sperm gamma-aminobutyric acid type A receptor delta subunit (GABRD) and its interaction with purinergic P2X2 receptors in progesterone-induced acrosome reaction and male fertility. | ||
Mol Nutr Food Res As a Histone Deacetylase Inhibitor, γ-Aminobutyric Acid Upregulates GluR2 Expression: An In Vitro and In Vivo Study. | 





