• Featured Product
  • KD/KO Validated

FIS1 Polyclonal antibody

The FIS1 polyclonal antibody (10956-1-AP) is the highest cited FIS1 antibody in the market with 390 citations.
Cat No. 10956-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig and More (6)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

TTC11, TPR repeat protein 11, hFis1, FIS1 homolog, CGI-135

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, mouse brain tissue, rat brain tissue, mouse heart tissue, SH-SY5Y cells, pig brain tissue, HeLa cells, rat heart tissue, Jurkat cells, mouse spleen tissue, rat spleen tissue, HepG2 cells, PC-12 cells
Positive IP detected inHeLa cells
Positive IHC detected inrat brain tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, Hepa1-6 cells, HepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:14000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10956-1-AP targets FIS1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken, zebrafish, hamster, goat, duck
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1409

Product name: Recombinant human FIS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-152 aa of BC009428

Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

Predict reactive species
Full Name fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Calculated Molecular Weight 17 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC009428
Gene Symbol FIS1
Gene ID (NCBI) 51024
RRIDAB_2102532
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y3D6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fis1 (fission 1) is an integral mitochondrial outer membrane protein that participates in mitochondrial fission by interacting with dynamin-related protein 1 (Drp1). Excessive mitochondrial fission is associated with the pathology of a number of neurodegenerative or neurodevelopmental diseases. Increased expression of Fis1 has been found in Huntington's disease (HD)-affected brain, Alzheimer's disease (AD) patients, and autism spectrum disorder. This antibody was raised against the full-length of human Fis1 protein, and recognizes endogenous Fis1 protein in various lysates. (PMID: 21257639, 21459773, 23333625)

Protocols

Product Specific Protocols
IF protocol for FIS1 antibody 10956-1-APDownload protocol
IHC protocol for FIS1 antibody 10956-1-APDownload protocol
IP protocol for FIS1 antibody 10956-1-APDownload protocol
WB protocol for FIS1 antibody 10956-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nature

Restoring metabolism of myeloid cells reverses cognitive decline in ageing.

Authors - Paras S Minhas
WB,IF

Nature

Distinct fission signatures predict mitochondrial degradation or biogenesis.

Authors - Tatjana Kleele
  • KO Validated
humanWB

Nat Immunol

RNA viruses promote activation of the NLRP3 inflammasome through a RIP1-RIP3-DRP1 signaling pathway.

Authors - Xiaqiong Wang
  • KD Validated
humanWB,IF

Cell Stem Cell

AMPK/FIS1-Mediated Mitophagy Is Required for Self-Renewal of Human AML Stem Cells.

Authors - Shanshan Pei
  • KD Validated
humanWB

Cell Metab

Fatty Liver Disease Caused by High-Alcohol-Producing Klebsiella pneumoniae.

Authors - Jing Yuan
mouseWB,IP

Nat Metab

Mitochondrial fission drives neuronal metabolic burden to promote stress susceptibility in male mice

Authors - Wan-Ting Dong

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Megan (Verified Customer) (06-22-2021)

RPE cell over-expressing pcDNA hFis1. Note 1:500 was used here to detect over-expressed Fis1, but we also use 1:100 when detecting endogenous Fis1. Also successfully used to detect endogenous Fis1 levels via Western Blot (used @ 1:1000).

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:100 - 1:500
  • Cell Tissue Type: RPE
FIS1 Antibody Western Blot,Immunofluorescence validation (1:100 - 1:500 dilution) in RPE (Cat no:10956-1-AP)
FH

Siting (Verified Customer) (01-28-2020)

This antibody worked perfectly for western blot.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse heart tissue
FH

Chun (Verified Customer) (07-03-2019)

This antibody is excellent/

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:2,000
  • Cell Tissue Type: HEK293 and HeLa cells, and primary rat cortical neurons
FH

Kishor (Verified Customer) (12-13-2018)

I got good results in both rat liver protein and H69 cells.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: H69, HUCCT-1
FIS1 Antibody Western Blot, validation (1:1000 dilution) in H69, HUCCT-1 (Cat no:10956-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...