CD36 Monoclonal antibody

CD36 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA
Cat No. 66395-1-Ig
Clone No.1A8C5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

GPIV, GPIIIB, GP4, GP3B, Glycoprotein IIIb

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman heart tissue, human milk, human spleen tissue, human placenta tissue
Positive IHC detected inhuman spleen tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman liver cancer tissue, THP-1 cells
Positive IF/ICC detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66395-1-Ig targets CD36 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13541

Product name: Recombinant human CD36 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-472 aa of BC008406

Sequence: MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK

Predict reactive species
Full Name CD36 molecule (thrombospondin receptor)
Calculated Molecular Weight 472 aa, 53 kDa
Observed Molecular Weight 88 kDa
GenBank Accession NumberBC008406
Gene Symbol CD36
Gene ID (NCBI) 948
RRIDAB_2811030
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP16671
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Function

CD36, also known as platelet glycoprotein 4, is an integral membrane glycoprotein that acts as a scavenger receptor. CD36 can bind to multiple ligands, including thrombospondin-1, collagen, oxidized phospholipids, oxidized low-density lipoprotein, and long-chain fatty acids. CD36 can also bind to erythrocytes parasitized by Plasmodium falciparum and apoptotic cells. CD36 mediates different biological processes, acting as a signaling hub in angiogenesis, inflammatory response, and fatty acid metabolism.

Tissue specificity

CD36 is present on the surface of various cells types, such as adipocytes, monocytes, macrophages, platelets, microvascular endothelial cells, dendritic cells, and hematopoietic precursors of red cells.

Involvement in disease
  • Mutations in CD36 can give rise to platelet glycoprotein IV deficiency, a type of macrothrombocytopenia.

  • Polymorphisms in CD36 can increase susceptibility to malaria.

  • AAGIC haplotype at the CD36 locus increases the risk of coronary heart disease.

  • Disruption of CD36-dependent pathways and certain SNPs in the CD36 gene are attributed to impaired fatty acid metabolism, glucose intolerance, Alzheimer's disease, atherosclerosis, arterial hypertension, diabetes, and cardiomyopathy.

Isoforms

Apart from the full-length protein (isoform 1), one additional shorter isoform has been reported (PMID: 7509795). Other alternative isoforms have also been detected on the mRNA level (PMID: 17673938).

Post-translational modifications

The extracellular domain of CD36 is extensively glycosylated. Glycosylation is needed for the transport of CD36 to the plasma membrane, as well as mediating recognition and binding to ligands. Cytoplasmic tails of transmembrane domains can be phosphorylated and play a role in signal transduction. Intracellular domains can be additionally acetylated, ubiquitinated, and palmitoylated (PMID: 28919632).

Cellular localization

CD36 is present on the cell surface.            

Protocols

Product Specific Protocols
IF protocol for CD36 antibody 66395-1-IgDownload protocol
IHC protocol for CD36 antibody 66395-1-IgDownload protocol
WB protocol for CD36 antibody 66395-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Metab

Targeting Erbin-mitochondria axis in platelets/megakaryocytes promotes B cell-mediated antitumor immunity

Authors - Zilong Zhang
WB

Oxid Med Cell Longev

Idol Depletion Protects against Spontaneous Atherosclerosis in a Hamster Model of Familial Hypercholesterolemia.

Authors - Chenxi Liang
IHC

Int J Biol Sci

LAMC1-mediated preadipocytes differentiation promoted peritoneum pre-metastatic niche formation and gastric cancer metastasis.

Authors - Yan Fang
humanWB

Front Oncol

Multi-Omics Analysis of Fatty Acid Metabolism in Thyroid Carcinoma.

Authors - Jinghui Lu
IF

Cells

The Exocyst Is Required for CD36 Fatty Acid Translocase Trafficking and Free Fatty Acid Uptake in Skeletal Muscle Cells

Authors - Nicole K. Nakamura
WB

Food Funct

CD36 and DGAT2 facilitate the lipid-lowering effect of chitooligosaccharides via fatty acid intake and triglyceride synthesis signaling.

Authors - Xin Shen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Wojciech (Verified Customer) (12-22-2022)

66395-1-Ig works very well at 1:1000 in Jurkat cells. Detected molecular weight was ~90 kDa.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Jurtkat
FH

Wojciech (Verified Customer) (12-19-2022)

CD36 Mouse McAb worked very well with WB at 1:1000 in Jurkat cells. A strong band ~90 kDa was detected.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Jurkat cells
Loading...
||
New chat

Able

正在加载,请稍候...