Tested Applications
Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
28206-1-AP targets CD21 in IHC, IF-P, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27971 Product name: Recombinant human CR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 660-718 aa of BC136394 Sequence: GCQSPPGLHHGRHTGGNTVFFVSGMTVDYTCDPGYLLVGNKSIHCMPSGNWSPSAPRCE Predict reactive species |
Full Name | complement component (3d/Epstein Barr virus) receptor 2 |
Calculated Molecular Weight | 1092 aa, 119 kDa |
GenBank Accession Number | BC136394 |
Gene Symbol | CD21 |
Gene ID (NCBI) | 1380 |
ENSEMBL Gene ID | ENSG00000117322 |
RRID | AB_2881087 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P20023 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD21, also known as complement receptor type 2 (CR2), complement C3d receptor, and Epstein-Barr virus receptor, is a transmembrane protein that contains a small cytoplasmic domain, a transmembrane region and an extracellular domain consisting of 15 tandem short consensus repeat sequences (PMID: 6230668; 2551147). It is expressed on B cells, follicular dendritic cells, thymocytes and a subset of peripheral T cells (PMID: 26119182). CD21 binds complement fragments C3d, C3dg and iC3b and acts as a receptor for the Epstein-Barr virus (PMID: 7753047). On B cells, together with CD19 and CD81, CD21 forms a complex that functions as a co-receptor to the BCR (PMID: 7542009). It is involved in B cells activation and functions.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for CD21 antibody 28206-1-AP | Download protocol |
IF protocol for CD21 antibody 28206-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |