SARS-CoV-2 S protein (126-264 aa) Polyclonal antibody

SARS-CoV-2 S protein (126-264 aa) Polyclonal Antibody for ELISA
Cat No. 28869-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Virus

Applications

WB, IP, ELISA

SARS-CoV-2 Spike Glycoprotein (126-264 aa), spike, spike protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive ELISA detected inRecombinant protein

Recommended dilution

ApplicationDilution
Enzyme-linked Immunosorbent Assay (ELISA)ELISA :
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28869-1-AP targets SARS-CoV-2 S protein (126-264 aa) in WB, IP, ELISA applications and shows reactivity with Virus samples.

Tested Reactivity Virus
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30679

Product name: Recombinant virus spike protein protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 126-264 aa of NC_045512

Sequence: VVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAA

Predict reactive species
Full Name SARS-CoV-2 Spike Protein
Calculated Molecular Weight 141 kDa
GenBank Accession NumberNC_045512
Gene Symbol SARS-COV-2
Gene ID (NCBI) 43740568
RRIDAB_2881225
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Coronaviruses (CoVs) infect human and animals and cause varieties of diseases, including respiratory, enteric, renal, and neurological diseases. CoV uses its spike protein to recognize ACE2 as its receptors and mediate membrane fusion and virus entry into host cells(PMID: 32221306). Each monomer of trimeric S protein is about 180 kDa, and contains two subunits, S1 and S2,S1 recognizes and binds to host receptors, and subsequent conformational changes in S2 facilitate fusion between the viral envelope and the host cell membrane(PMID: 19198616). Although the amino acid sequences of the S-glycoprotein were found to be different between the various HCoV, the structures showed high similarity, but the best 3D structural overlap shared by SARS-CoV and SARS-CoV-2, consistent with the shared ACE2 predicted receptor (PMID: 32522207). The spike protein of CoVs can be a target for vaccine and therapeutic development (PMID: 19198616). 28869-1-AP is specific for spike protein of SARS-COV-2, that antigen region is 126-264aa.

Publications

SpeciesApplicationTitle
WB,IP

EBioMedicine

Primate-specific BTN3A2 protects against SARS-CoV-2 infection by interacting with and reducing ACE2

Authors - Ling Xu
WB

ACS Appl Mater Interfaces

Promoting Drug Delivery to the Brain by Modulating the Transcytosis Process across the Blood-Brain Barrier

Authors - Li Zhang
Loading...
||
New chat Able
正在加载,请稍候...