p38 MAPK Polyclonal antibody

• 

  WB analysis using 14064-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14064-1-AP (p38 MAPK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 14064-1-AP

  WB result of p38 antibody (14064-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-p38 transfected Jurkat cells.

• 

  WB analysis using 14064-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14064-1-AP (p38 MAPK antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14064-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14064-1-AP (p38 MAPK antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14064-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14064-1-AP (p38 MAPK antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 14064-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14064-1-AP (p38 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 14064-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14064-1-AP (p38 MAPK antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 14064-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14064-1-AP (p38 MAPK antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 14064-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14064-1-AP (p38 MAPK antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 14064-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14064-1-AP (p38 MAPK antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 14064-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14064-1-AP (p38 MAPK antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 14064-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14064-1-AP (p38 MAPK antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

p38 MAPK Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14064-1-AP

Publications(530)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF, ELISA

Synonyms

MAPK14, Cytokine suppressive anti-inflammatory drug-binding protein, CSPB1, CSBP2, CSBP1

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse heart tissue, Jurkat cells, RAW 264.7 cells, Neuro-2a cells, NIH/3T3 cells, rat spleen tissue, rat heart tissue, K-562 cells
• Positive IHC detected in: human colon cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 509 publications below
• IHC: See 14 publications below
• IF: See 13 publications below

Product Information

14064-1-AP targets p38 MAPK in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, rabbit, chicken, zebrafish, goat, fish, duck
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5115

  Product name: Recombinant human p38 MAPK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-307 aa of BC031574

  Sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAY

• Full Name: mitogen-activated protein kinase 14
• Calculated Molecular Weight: 360 aa, 41 kDa
• Observed Molecular Weight: 38-42 kDa
• GenBank Accession Number: BC031574
• Gene Symbol: p38 MAPK
• Gene ID (NCBI): 1432
• RRID: AB_2878007
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16539
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAPK14(mitogen-activated protein kinase 14) is also named as SAPK2A, p38MAPK, CSBP1, RK, p38, EXIP, Mxi2, CSBP2, PRKM14, PRKM15, CSPB1, p38ALPHA and belongs to the MAP kinase subfamily. MAPK14-signaling is a central pathway for the integration of instructive signals in dendritic cells for T(H)17 differentiation and inflammation(PMID:22231518). It plays an important role in the regulation of hematopoietic stem cellself-renewal in vitro and inhibition of MAPK14 activation with a small molecule inhibitor may represent a novel approach to promote ex vivo expansion of hematopoietic stem cell(PMID:21198398). This protein has some isoforms with MW 29-31 kDa, 35 kDa and 41 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Discov; The Meningioma Enhancer Landscape Delineates Novel Subgroups and Drives Druggable Dependencies.; Authors - Briana C Prager
human	WB	Nat Commun; Aggresome formation promotes ASK1/JNK signaling activation and stemness maintenance in ovarian cancer; Authors - Yurou Chen
	WB	Mol Cell; PARP5A and RNF146 phase separation restrains RIPK1-dependent necroptosis; Authors - Shouqiao Hou
mouse	WB	Brain Behav Immun; Egln3 expression in microglia enhances the neuroinflammatory responses in Alzheimer's disease; Authors - Jiaxin Guan
	WB	Sci Adv; Asparagine transporter supports macrophage inflammation via histone phosphorylation; Authors - Chuanlong Wang
mouse	WB	Redox Biol; Deficiency of S100 calcium binding protein A9 attenuates vascular dysfunction in aged mice; Authors - Boying Zhao