p38 MAPK Polyclonal antibody

• Home
• Products
• Primary Antibodies
• p38 MAPK Polyclonal antibody (14064-1-AP)

• Featured Product
• KD/KO Validated

p38 MAPK Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14064-1-AP Copied!

Publications (846)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (6)

Applications

WB, IHC, IF, ELISA

Synonyms

MAPK14, CSAID-binding protein, CSBP, CSBP1, CSBP2

• 

  WB analysis of Jurkat using 14064-1-AP

  WB result of p38 antibody (14064-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-p38 transfected Jurkat cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14064-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14064-1-AP (p38 MAPK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14064-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14064-1-AP (p38 MAPK antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14064-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14064-1-AP (p38 MAPK antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of RAW 264.7 using 14064-1-AP

  N/A

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14064-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14064-1-AP (p38 MAPK antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 14064-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14064-1-AP (p38 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 14064-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14064-1-AP (p38 MAPK antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 14064-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14064-1-AP (p38 MAPK antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 14064-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14064-1-AP (p38 MAPK antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 14064-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14064-1-AP (p38 MAPK antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 14064-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14064-1-AP (p38 MAPK antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 14064-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14064-1-AP (p38 MAPK antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 14064-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 14064-1-AP (p38 MAPK antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for p38 MAPK in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, mouse heart tissue, RAW 264.7 cells, NIH/3T3 cells, rat spleen tissue, Neuro-2a cells, rat heart tissue, K-562 cells
• Positive IHC detected in: human colon cancer tissue, human liver cancer tissue, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14064-1-AP targets p38 MAPK in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, rabbit, chicken, zebrafish, goat, fish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5115

  Product name: Recombinant human p38 MAPK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-307 aa of BC031574

  Sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAY

• Full Name: mitogen-activated protein kinase 14
• Calculated Molecular Weight: 360 aa, 41 kDa
• Observed Molecular Weight: 38-42 kDa
• GenBank Accession Number: BC031574
• Gene Symbol: p38 MAPK
• Gene ID (NCBI): 1432
• RRID: AB_2878007
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16539
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAPK14(mitogen-activated protein kinase 14) is also named as SAPK2A, p38MAPK, CSBP1, RK, p38, EXIP, Mxi2, CSBP2, PRKM14, PRKM15, CSPB1, p38ALPHA and belongs to the MAP kinase subfamily. MAPK14-signaling is a central pathway for the integration of instructive signals in dendritic cells for T(H)17 differentiation and inflammation(PMID:22231518). It plays an important role in the regulation of hematopoietic stem cellself-renewal in vitro and inhibition of MAPK14 activation with a small molecule inhibitor may represent a novel approach to promote ex vivo expansion of hematopoietic stem cell(PMID:21198398). This protein has some isoforms with MW 29-31 kDa, 35 kDa and 41 kDa.

Publications

What published studies show

p38 MAPK Polyclonal antibody (Cat# 14064-1-AP) has accumulated 846 citations across journals including Nature Communications, Nature Cell Biology, Molecular Cell, Science Advances, Cell Reports, EMBO Molecular Medicine, Journal of Experimental Medicine, Advanced Materials, ACS Nano, Cancer Discovery, and Immunity. Research fields span oncology, immunology, neuroinflammation, cardiovascular disease, metabolic disorders, ferroptosis, bone/joint pathology, liver and kidney disease, gut microbiota, and pharmacology.

Automatically generated from the 846 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Cancer; Targeting BATF2-RGS2 axis reduces T-cell exhaustion and restores anti-tumor immunity; Authors - Xuyu Gu
mouse	WB	Immunity; Innate immune sensing of Z-nucleic acids by ZBP1-RIPK1 axis drives neuroinflammation in Alzheimer's disease.; Authors - Ziwen Song
human	WB	Cancer Discov; The Meningioma Enhancer Landscape Delineates Novel Subgroups and Drives Druggable Dependencies.; Authors - Briana C Prager
mouse	WB,IHC,IF,ELISA	Adv Mater; Ultrasound-Activated Sonophage Synergizes Sonodynamic Therapy and Saltoptosis for Solid Tumor Eradication.; Authors - Kerong Chen
rat	WB	Mil Med Res; D-mannose alleviates intervertebral disc degeneration through glutamine metabolism; Authors - Zheng-Lin Dong
mouse	WB	Cancer Commun (Lond); Reciprocal tumor-platelet interaction through the EPHB1-EFNB1 axis in the liver metastatic niche promotes metastatic tumor outgrowth in pancreatic ductal adenocarcinoma; Authors - Lin-Li Yao