Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse cerebellum tissue, human brain tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse cerebellum tissue |
| Positive FC (Intra) detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66412-1-Ig targets Alpha Synuclein in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1285 Product name: Recombinant human a-Synuclein protein Source: e coli.-derived, PKG Tag: GST Domain: 1-140 aa of BC013293 Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA Predict reactive species |
| Full Name | synuclein, alpha (non A4 component of amyloid precursor) |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 18-19 kDa |
| GenBank Accession Number | BC013293 |
| Gene Symbol | Alpha Synuclein |
| Gene ID (NCBI) | 6622 |
| RRID | AB_2881784 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P37840 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Alpha Synuclein (α-syn) is a 14-19 kDa phosphoprotein that is primarily localize to the presynaptic terminals of mature neurons, where it is involved in synaptic function and plasticity. α-syn has drawn intense interest ever since the late 1990s, when the first α-synuclein missense mutation was identified as a cause of familial Parkinson's disease (PD). Aggregated and hyper-phosphorylated forms of α-syn protein are the pathological hallmark of Lewy body disease, which includes Parkinson's disease (PD), diffuse Lewy body disease (DLBD), and Lewy body variant of Alzheimer's disease (LBV). This antibody can recognize all the isoforms of α-syn.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Alpha Synuclein antibody 66412-1-Ig | Download protocol |
| IF protocol for Alpha Synuclein antibody 66412-1-Ig | Download protocol |
| IHC protocol for Alpha Synuclein antibody 66412-1-Ig | Download protocol |
| WB protocol for Alpha Synuclein antibody 66412-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-SNCA (alpha-synuclein) antibody (Cat# 66412-1-Ig) has 11 citations published in journals including Nature Communications, Autophagy, NPJ Parkinson's Disease, FASEB Journal, Molecular Neurobiology, Journal of Neuropathology & Experimental Neurology, Applied Microbiology and Biotechnology, Biomedical Pharmacotherapy, Metabolic Brain Diseases, and Biochemical and Biophysical Research Communications. The research fields span Parkinson's disease, neurodegeneration, autophagy/mitophagy, and ischemic cardiomyopathy.
| Species | Application | Title |
|---|---|---|
Autophagy SNCA/synuclein alpha impairs endometrial receptivity in obesity by disrupting STUB1-TFEB-mediated autophagy. | ||
Nat Commun DNA nanoflower Oligo-PROTAC for targeted degradation of FUS to treat neurodegenerative diseases | ||
NPJ Parkinsons Dis Urea cycle dysregulation drives metabolic stress and neurodegeneration in Parkinson's disease | ||
Appl Microbiol Biotechnol The alteration of intestinal mucosal α-synuclein expression and mucosal microbiota in Parkinson's disease |
Reviews
What customers say
Users generally rate this antibody positively (average ~4.2/5 across 6 reviews), with most using it successfully for Western Blot at dilutions of 1:1000–1:3000. Several reviewers report clear, specific bands at the expected ~17 kDa molecular weight in mouse brain lysates and cell lines. Two users gave lower ratings: one observed a very weak band, while another noted unexpected higher bands up to 50 kDa despite the expected range of 14–18 kDa. Overall, the antibody is well-regarded for WB and IF applications, though results may vary depending on sample type and conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ali (Verified Customer) (04-16-2026) | Tested in western blot and Immunofluorescnece, works perfectly in both
|
Boyan (Verified Customer) (01-13-2026) | very weak band around the expected molecular weight
|
Janelle (Verified Customer) (09-12-2022) | Perfect for WB!
|
BISHR (Verified Customer) (05-10-2022) | I used it in WB with 1:1000 ration, the band was clear and almost perfect. However, it says the expected kd ranges from 14 to 18, unfortunately I am getting far higher bands up to 50 kd sometimes. Although I am using concentrated acrylamide in the gel, it is making it difficult for reviewers to understand that.
 |
q (Verified Customer) (01-05-2022) | It is good in WB with a specific band at 17 kd around.
 |
Sheela (Verified Customer) (07-16-2019) | This product worked as expected
 |
