YTHDF2 Polyclonal antibody

• 

  WB analysis using 24744-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24744-1-AP (YTHDF2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 24744-1-AP

  WB result of YTHDF2 antibody (24744-1-AP, 1:4000) with si-control and si-YTHDF2 transfected Jurkat cells..

• 

  WB analysis using 24744-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24744-1-AP (YTHDF2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 24744-1-AP

  IP result of anti-YTHDF2 (IP:24744-1-AP, 4ug; Detection:24744-1-AP 1:6000) with HeLa cells lysate 1360 ug.

• 

  IHC staining of mouse brain using 24744-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24744-1-AP (YTHDF2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 24744-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24744-1-AP (YTHDF2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 24744-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using YTHDF2 antibody (24744-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 24744-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using YTHDF2 antibody (24744-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of U2OS using 24744-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using YTHDF2 antibody (24744-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HeLa using 24744-1-AP

  Immunofluorescent analysis of (4% PFA) fixed sodium arsenite treated HeLa cells using YTHDF2 antibody (24744-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-phalloidin (green).

• 

  IF Staining of HeLa using 24744-1-AP

  Immunofluorescent analysis of HeLa cells using 24744-1-AP (YTHDF2 antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG.

• Featured Product
• KD/KO Validated

The YTHDF2 polyclonal antibody (24744-1-AP) is the highest cited YTHDF2 antibody in the market with 364 citations.

Cat No. 24744-1-AP

Publications(364)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (6)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, chIP, RIP, ELISA, CLIP

Synonyms

CLL associated antigen KW 14, CLL-associated antigen KW-14, DF2, HGRG8, NY REN 2

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells, HeLa cells, MOLT-4 cells, NIH/3T3 cells, C6 cells, Raji cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue
• Positive IF/ICC detected in: U2OS cells, HeLa cells, sodium arsenite treated HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 90 publications below
• WB: See 290 publications below
• IHC: See 25 publications below
• IF: See 52 publications below
• IP: See 20 publications below
• CoIP: See 11 publications below
• ChIP: See 1 publications below
• RIP: See 77 publications below

Product Information

24744-1-AP targets YTHDF2 in WB, IHC, IF/ICC, IF-P, IP, CoIP, chIP, RIP, ELISA, CLIP applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, monkey, chicken, bovine, sheep, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5922

  Product name: Recombinant human YTHDF2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 339-565 aa of BC002559

  Sequence: LSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQE

• Full Name: YTH domain family, member 2
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC002559
• Gene Symbol: YTHDF2
• Gene ID (NCBI): 51441
• RRID: AB_2687435
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5A9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

YTHDF2 also named as CLL associated antigen KW 14 or HGRG8 is a 579 amino acid protein, which contains one YTH domain and exists as two alternatively spliced isoforms. YTHDF2 is expressed in in pancreas, testis and placenta. YTHDF2 may play a role in human longevity. Due to the high sequence similarity, 24744-1-AP is likely to cross-react with both YTHDF1 and YTHDF3.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Nature; m6A enhances the phase separation potential of mRNA.; Authors - Ryan J Ries
mouse	RIP	Nature; m6A RNA methylation regulates the fate of endogenous retroviruses.; Authors - Tomasz Chelmicki ; KO Validated
mouse	WB	Nature; m6A facilitates hippocampus-dependent learning and memory through YTHDF1.; Authors - Hailing Shi
mouse,human	WB,IF	Nature; Dynamic m(6)A mRNA methylation directs translational control of heat shock response.; Authors - Jun Zhou
human	WB	Cell; G3BP1 Is a Tunable Switch that Triggers Phase Separation to Assemble Stress Granules.; Authors - Peiguo Yang
mouse,human		Nat Med; Stem cell architecture drives myelodysplastic syndrome progression and predicts response to venetoclax-based therapy.; Authors - Irene Ganan-Gomez

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Tatyana (Verified Customer) (12-22-2024)

Works well in WB, ICC and IHC. ICC with antibody diluted in 5% goat serum in PBST, with 2 h incubation at RT. Cytoplasmic staining, recognises stress granules. WB with antibody diluted in 4% milk in TBST, with ON incubation. Also gives what looks like specific staining in mouse spinal cord (DAB and fluorescence).

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HeLa and SH-SY5Y cells/human; mouse tissue

YTHDF2 Antibody Western Blot,Immunohistochemistry,Immunofluorescence validation (1:1000 dilution) in HeLa and SH-SY5Y cells/human; mouse tissue (Cat no:24744-1-AP)

FH

Jinyun (Verified Customer) (08-26-2022)

I did the western blot, and the antibody worked quite well.

• Applications: Western Blot
• Primary Antibody Dilution: 1:3000

FH

Robert (Verified Customer) (01-24-2019)

1. scrambled siRNA2. YTHDF2 siRNA

• Applications: Western Blot,
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: ST cells (porcine)

YTHDF2 Antibody Western Blot, validation (1/1000 dilution) in ST cells (porcine) (Cat no:24744-1-AP)