Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, A549 cells, mouse brain tissue, rat brain tissue, HEK-293 cells, Jurkat cells, MCF-7 cells, NIH/3T3 cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human kidney tissue, human hypothalamus tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17479-1-AP targets YTHDF1 in WB, IHC, IF/ICC, IF-P, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken, zebrafish, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11509 Product name: Recombinant human YTHDF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 210-559 aa of BC050284 Sequence: VALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ Predict reactive species |
| Full Name | YTH domain family, member 1 |
| Calculated Molecular Weight | 559 aa, 61 kDa |
| Observed Molecular Weight | 60 kDa |
| GenBank Accession Number | BC050284 |
| Gene Symbol | YTHDF1 |
| Gene ID (NCBI) | 54915 |
| RRID | AB_2217473 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BYJ9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
YTHDF1, also named YTH domain-containing family protein 1 or C20orf21, is a 559 amino acid protein, which localizes in the cytoplasm. YTHDF1 specifically recognizes and binds N6-methyladenosine (m6A)-containing mRNAs, and promotes mRNA translation efficiency. M6A is a modification present at the internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing, and stability. YTHDF1 acts as a regulator of mRNA translation efficiency: promotes ribosome loading to m6A-containing mRNAs and interacts with translation initiation factors eIF3 (EIF3A or EIF3B) to facilitate translation initiation. YTHDF1 exists two isoforms and the calculated molecular weight of isoforms are 61 kDa and 21 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for YTHDF1 antibody 17479-1-AP | Download protocol |
| IHC protocol for YTHDF1 antibody 17479-1-AP | Download protocol |
| IP protocol for YTHDF1 antibody 17479-1-AP | Download protocol |
| WB protocol for YTHDF1 antibody 17479-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nature m6A facilitates hippocampus-dependent learning and memory through YTHDF1.
| ||
Cell A Unified Model for the Function of YTHDF Proteins in Regulating m6A-Modified mRNA.
| ||
Cell G3BP1 Is a Tunable Switch that Triggers Phase Separation to Assemble Stress Granules. | ||
Cell The Mammalian Ribo-interactome Reveals Ribosome Functional Diversity and Heterogeneity. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Mounika (Verified Customer) (12-25-2025) | Antibodies are excellent, visibility is goog
|
FH Vikas (Verified Customer) (12-23-2024) | Works very good. used for WB.
|
FH RASHMI (Verified Customer) (11-27-2024) | Works great in WB
|
FH Fanpeng (Verified Customer) (03-14-2024) | Good for immunostaining and WB analysis using brain tissues and multiple brain cells.
|
FH Tatyana (Verified Customer) (12-04-2023) | Works well in WB and also gives a cytoplasmic signal in ICC, although it is fairly week. Also works in PLA.
![]() |
FH Shinford (Verified Customer) (10-26-2023) | We conducted tests on various m6A-related modulators, and the antibodies related to the YTHDF family consistently performed well. Even at a lower concentration of 1:3000, they yielded satisfactory results.
![]() |
FH Sarah (Verified Customer) (01-05-2021) | Works great in WB at 1/1000 (5% Milk TBS Tween). Tested on HeLa and 293T lysates;
|
FH Hannah (Verified Customer) (08-14-2020) | Band observed by WB of correct size that is reduced with siRNA knockdown but required long exposure or Pico supersignal ECL for a good signal from fibroblast lysates
|
FH Biao (Verified Customer) (03-11-2020) | This antibody is very specific and good quality.
|
FH Zizhao (Verified Customer) (12-03-2018) |
![]() |
























