Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

WNT1 Polyclonal antibody

WNT1 Polyclonal Antibody for WB, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

INT1, Proto oncogene Int 1 homolog, Proto oncogene Wnt 1, Proto-oncogene Int-1 homolog, Proto-oncogene Wnt-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for WNT1 in ?

Tested Applications

Positive WB detected in3T3-L1 cells, HepG2 cells, NIH/3T3 cells, Jurkat cells
Positive IF/ICC detected inNIH/3T3 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27935-1-AP targets WNT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27380

Product name: Recombinant human WNT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 228-323 aa of BC074799

Sequence: TVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALD

Predict reactive species
Full Name wingless-type MMTV integration site family, member 1
Observed Molecular Weight 41 kDa
GenBank Accession NumberBC074799
Gene Symbol WNT1
Gene ID (NCBI) 7471
RRIDAB_2881013
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04628
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Wingless-related MMTV integration site 1 (Wnt1), a cysteine-rich glycosylated protein related to the Drosophila protein Wingless, has been shown to inhibit microglial inflammatory activation in a variety of CNS diseases, such as ischemic reperfusion injury in the brain, intracerebral hemorrhage, Alzheimer's disease, and Parkinson's disease (PMID: 40025242). Wnt1 is expressed in the dorsal part, and it is necessary for the maintenance of Fgf8 expression. This molecule is essential for the induction of the midbrain and the cerebellum (PMID: 34722541, PMID: 1583219). Wnt1 as a bone anabolic Wnt ligand in long bones and in alveolar bone and cementum formation during tooth maintenance (PMID: 30404864, PMID: 34009051). Wnt1 is a key regulator of neural crest cells, which constitute most of the facial mesenchymal cells (PMID:792502).

Protocols

Product Specific Protocols
IF protocol for WNT1 antibody 27935-1-APDownload protocol
WB protocol for WNT1 antibody 27935-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The WNT1 Polyclonal antibody (Cat# 27935-1-AP) has accumulated 67 citations across diverse journals including Nature Communications, Kidney International, Cell Death & Disease, Scientific Reports, iScience, and Journal of Clinical Endocrinology & Metabolism. Research fields span Wnt/β-catenin signaling, fibrosis (renal, cardiac, hepatic), cancer biology, bone metabolism, neuroscience, cardiovascular disease, and traditional medicine mechanisms. Applications cited include WB, IHC, and IF across human, mouse, and rat species.

SpeciesApplicationTitle
mouseWB,IHC

Kidney Int

Non-canonical Wnt/calcium signaling is protective against podocyte injury and glomerulosclerosis

Authors - Dong Zhou
mouseWB

Nat Commun

FoxO3 controls cardiomyocyte proliferation and heart regeneration by regulating Sfrp2 expression in postnatal mice

Authors - Jing-Bo Xia
ratWB

Carbohydr Polym

A novel antidepressant homogeneous polysaccharide YLP-1 from Millettia pulchra ameliorates tryptophan metabolism and SCFAs through modulating gut microbiota

Authors - Meng Yu
mouseWB

Cell Death Dis

A noncoding regulatory RNA Gm31932 induces cell cycle arrest and differentiation in melanoma via the miR-344d-3-5p/Prc1 (and Nuf2) axis.

Authors - Dan Wang
mouseWB

Int J Biol Macromol

Polyporus Umbellatus polysaccharide ameliorates rheumatoid arthritis via inhibiting inflammation and regulating gut microbiota

Authors - Ziming Zheng
humanWB

Int J Mol Med

miR‑483‑3p promotes the osteogenesis of human osteoblasts by targeting Dikkopf 2 (DKK2) and the Wnt signaling pathway.

Authors - Bin Zhou
Loading...
||
New chat

Able™

正在加载,请稍候...