Mouse VEGFA164 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83572-2-PBS

  Biolayer interferometry (BLl) kinetic assays of 83572-2-PBS against Mouse VEGFA164 was performed. The affinity constant is below 1 pM.

VEGFA164 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83572-2-PBS

Clone No.240415G2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Indirect ELISA

Synonyms

Vegfa, L-VEGF , N-VEGF, Vascular Endothelial Growth Factor, vascular endothelial growth factor A

---

Product Information

83572-2-PBS targets VEGFA164 in Cytometric bead array, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0277

  Product name: Recombinant Mouse VEGFA protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*HIS

  Domain: 27-190 aa of NM_001287057

  Sequence: APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

• Full Name: vascular endothelial growth factor A
• Calculated Molecular Weight: 22kd
• GenBank Accession Number: NM_001287057
• Gene Symbol: Vegfa
• Gene ID (NCBI): 22339
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q00731-2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.