VEGFA Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• VEGFA Recombinant monoclonal antibody (81323-2-RR)

VEGFA Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 81323-2-RR Copied!

Clone No. 7H10

Publications (39)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IF/ICC, ELISA

Synonyms

VEGF, L-VEGF, N-VEGF, Vascular Endothelial Growth Factor, vascular endothelial growth factor A

• 

  WB analysis using 81323-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81323-2-RR (VEGFA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 81323-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81323-2-RR (VEGFA antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 81323-2-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using VEGFA antibody (81323-2-RR, Clone: 7H10 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 81323-2-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using VEGFA antibody (81323-2-RR, Clone: 7H10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 81323-2-RR

  Biolayer interferometry (BLl) kinetic assays of 81323-2-RR against Human VEGFA were performed. The affinity constant is 1.60 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for VEGFA in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells, A431 cells, U-251 cesll, U-87 MG cells, T-47D cells, MDA-MB-231 cells, HUVEC cells, RAW 264.7 cells
• Positive IF/ICC detected in: HeLa cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

81323-2-RR targets VEGFA in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13500

  Product name: Recombinant human VEGFA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-302 aa of BC065522

  Sequence: AAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

• Full Name: vascular endothelial growth factor A
• Calculated Molecular Weight: 412 aa, 46 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC065522
• Gene Symbol: VEGFA
• Gene ID (NCBI): 7422
• RRID: AB_3086457
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15692
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VEGFA, also named as VEGF or VPF, belongs to the PDGF/VEGF growth factor family. It is a growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. VEGFA induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. It binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Defects in VEGFA are associated with microvascular complications of diabetes type 1 (MVCD1). VEGFA has 17 isoforms with MW from 16 to 45 kDa. Some isoforms have homodimer forms (e.g.; VEGFA189 38 kDa or VEFGA110 34 kDa). VEGF-A exists in at least seven homodimeric isoforms. The monomers consist of 121, 145, 148, 165, 183, 189, or 206 amino acids (PMID:15602010 ).

Publications

What published studies show

The VEGFA Recombinant monoclonal antibody (7H10), catalog number 81323-2-RR, has accumulated 39 citations across journals including Biomaterials, Mater Today Bio, J Transl Med, Apoptosis, iScience, J Biol Chem, Diabetes, Life Sci, and Theranostics. Research fields span angiogenesis, diabetic wound healing, tumor microenvironment (HCC, glioblastoma, colorectal cancer), diabetic retinopathy, ferroptosis, nanomedicine, and vascular inflammation.

Automatically generated from the 39 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IF	Redox Biol; Phytochemical nanozymes reprogram redox for balanced antimicrobial and regenerative therapy in acute and chronic diabetic wounds; Authors - Yipeng Pang
		J Nanobiotechnology; High glucose-primed HUVEC-derived extracellular vesicles encapsulated in microgels boost diabetic ischaemic flap regeneration via HIF-1α/VEGF pathway.; Authors - Sheng Ding
mouse,human	WB,IF	Biomaterials; Chiral nanoassembly remodels tumor microenvironment through non-oxygen-dependent depletion lactate for effective photodynamic immunotherapy; Authors - Xuan Zhang
		Biomaterials; Tannic acid-reinforced anisotropic polyvinyl alcohol hydrogel for urethral stricture reconstruction.; Authors - Dajun Gao
	WB	J Control Release; Hyaluronic acid methacryloyl-based co-delivery system for aflibercept and miR-21-3p antagomir: a dual-therapeutic approach for diabetic retinopathy; Authors - Xisen Ni
human, mouse	WB	Mater Today Bio; Bionic intelligent responsive barbed microneedles synergistically remodel the microenvironment for the treatment of refractory pigmentation disorders (melasma).; Authors - Hao Ding