Use Able AI chat for product recommendations

VEGFA Recombinant monoclonal antibody

VEGFA Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 81323-2-RR
Clone No.7H10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IF/ICC, ELISA

VEGF, L-VEGF, N-VEGF, Vascular Endothelial Growth Factor, vascular endothelial growth factor A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, A431 cells, U-251 cesll, U-87 MG cells, T-47D cells, MDA-MB-231 cells, HUVEC cells, RAW 264.7 cells
Positive IF/ICC detected inHeLa cells, MCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81323-2-RR targets VEGFA in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13500

Product name: Recombinant human VEGFA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-302 aa of BC065522

Sequence: AAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Predict reactive species
Full Name vascular endothelial growth factor A
Calculated Molecular Weight 412 aa, 46 kDa
Observed Molecular Weight40 kDa
GenBank Accession NumberBC065522
Gene Symbol VEGFA
Gene ID (NCBI) 7422
RRIDAB_3086457
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15692
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VEGFA, also named as VEGF or VPF, belongs to the PDGF/VEGF growth factor family. It is a growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. VEGFA induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. It binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Defects in VEGFA are associated with microvascular complications of diabetes type 1 (MVCD1). VEGFA has 17 isoforms with MW from 16 to 45 kDa. Some isoforms have homodimer forms (e.g.; VEGFA189 38 kDa or VEFGA110 34 kDa). VEGF-A exists in at least seven homodimeric isoforms. The monomers consist of 121, 145, 148, 165, 183, 189, or 206 amino acids (PMID:15602010 ).

Protocols

Product Specific Protocols
IF protocol for VEGFA antibody 81323-2-RRDownload protocol
WB protocol for VEGFA antibody 81323-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

J Control Release

Hyaluronic acid methacryloyl-based co-delivery system for aflibercept and miR-21-3p antagomir: a dual-therapeutic approach for diabetic retinopathy

Authors - Xisen Ni

Sci China Life Sci

Transcriptional condensates enrich phosphorylated PRMT2 to stimulate H3R8me2a deposition and hypoxic response in glioblastoma

Authors - Feng Dong
humanWB

Oncol Lett

Overexpression and knockdown of 5-lipoxygenase regulates the migration and invasion of colorectal cancer cells.

Authors - Xuyang Li

Mater Today Bio

Injectable thermosensitive hydrogel incorporating exosome-loaded chitosan microspheres for immunomodulation and cartilage regeneration.

Authors - Li Xiong
mouseIF

iScience

Single-cell transcriptomic analyses reveal angiogenic vascular responses to chronic cerebral hypoperfusion.

Authors - Jiajing Shan

J Nanobiotechnology

High glucose-primed HUVEC-derived extracellular vesicles encapsulated in microgels boost diabetic ischaemic flap regeneration via HIF-1α/VEGF pathway.

Authors - Sheng Ding
Loading...
||
New chat

Able

正在加载,请稍候...