VAPB Monoclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 66191-1-Ig (same clone as 66191-1-PBS)

  WB result of VAPB antibody (66191-1-Ig, 1:5000) with si-control and si-VAPB transfected HepG2 cells. This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66191-1-Ig (same clone as 66191-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66191-1-Ig (VAPB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66191-1-Ig (same clone as 66191-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66191-1-Ig (VAPB antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66191-1-Ig (same clone as 66191-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66191-1-Ig (VAPB Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66191-1-Ig (same clone as 66191-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66191-1-Ig (VAPB Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 66191-1-Ig (same clone as 66191-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66191-1-Ig (VAPB antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66191-1-Ig (same clone as 66191-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using VAPB antibody (66191-1-Ig, Clone: 4F6A6 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66191-1-Ig (same clone as 66191-1-PBS)

  Immunofluorescent analysis of HepG2 cells using 66191-1-Ig (VAPB antibody) at dilution of 1:50 and Rhodamine-Goat anti-Mouse IgG. This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66191-1-Ig (same clone as 66191-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using VAPB antibody (66191-1-Ig, Clone: 4F6A6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red). This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 66191-1-Ig (same clone as 66191-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using VAPB antibody (66191-1-Ig, Clone: 4F6A6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66191-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

VAPB Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66191-1-PBS

Clone No.4F6A6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

4F6A6, ALS8, UNQ484/PRO983, VAMP associated protein B/C, VAMP B

---

Product Information

66191-1-PBS targets VAPB in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6313

  Product name: Recombinant human VAPB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 31-180 aa of BC001712

  Sequence: KLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEV

• Full Name: VAMP (vesicle-associated membrane protein)-associated protein B and C
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 30-32 kDa
• GenBank Accession Number: BC001712
• Gene Symbol: VAPB
• Gene ID (NCBI): 9217
• RRID: AB_2881586
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O95292
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Vesicle-associated membrane protein-associated protein B (VAPB) is an integral membrane protein localized to the endoplasmic reticulum (ER) membrane. VAPB has been implicated in various cellular processes, including ER stress, the unfolded protein response (UPR) and calcium homeostasis regulation. The mutations in the gene of VAPB cause amyotrophic lateral sclerosis 8 (ALS8) and some other related forms of motor neuron disease including late onset spinal muscular atrophy.