• Featured Product
  • KD/KO Validated

VAMP3/Cellubrevin Polyclonal antibody

VAMP3/Cellubrevin Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 10702-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA, Blocking

VAMP3, CEB, Cellubrevin, SYB3, Synaptobrevin-3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, MCF-7 cells, mouse brain tissue
Positive IP detected inHEK-293 cells
Positive IHC detected inmouse testis tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10702-1-AP targets VAMP3/Cellubrevin in WB, IHC, IF, IP, ELISA, Blocking applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1156

Product name: Recombinant human VAMP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-99 aa of BC005941

Sequence: MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCEMWAIGITVLVIFIIIIIVWVVS

Predict reactive species
Full Name vesicle-associated membrane protein 3 (cellubrevin)
Calculated Molecular Weight 11 kDa
Observed Molecular Weight 11-17 kDa
GenBank Accession NumberBC005941
Gene Symbol VAMP3
Gene ID (NCBI) 9341
RRIDAB_2212628
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15836
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VAMP3, also named as cellubrevin or synaptobrevin 3, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. VAMP3 is a v-SNARE (soluble NSF-attachment protein receptor). Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP3 resides in recycling endosomes and endosome-derived transport vesicles, involved in regulating membrane traffic. It is implicated in recycling of transferrin receptors, secretion of alpha-granules in platelets, and membrane trafficking during cell migration.

Protocols

Product Specific Protocols
IHC protocol for VAMP3/Cellubrevin antibody 10702-1-APDownload protocol
IP protocol for VAMP3/Cellubrevin antibody 10702-1-APDownload protocol
WB protocol for VAMP3/Cellubrevin antibody 10702-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseBlocking

Adv Sci (Weinh)

Engineered Cell-Derived Microparticles Bi2Se3/DOX@MPs for Imaging Guided Synergistic Photothermal/Low-Dose Chemotherapy of Cancer.

Authors - Dongdong Wang
humanWB,IF

Adv Sci (Weinh)

Early Endosomes Act as Local Exocytosis Hubs to Repair Endothelial Membrane Damage

Authors - Nikita Raj
humanWB,IF

Nat Commun

KRAS regulation by small non-coding RNAs and SNARE proteins.

Authors - Yonglu Che
ratWB,IF

Aging Cell

Knockdown of astrocytic Grin2a aggravates β-amyloid-induced memory and cognitive deficits through regulating nerve growth factor.

Authors - Zunshu Du
humanWB,IF

Oncogene

Syntaxin-6 mediated autophagy confers lenvatinib resistance in hepatocellular carcinoma

Authors - Guo-Pei Zhang
humanIHC

Oncotarget

A novel liver metastasis-correlated protein of pancreatic neuroendocrine neoplasm (PanNEN) discovered by proteomic analysis.

Authors - Mitsuhiro Shimura
Loading...
||
New chat Able
正在加载,请稍候...