VAMP3/Cellubrevin Polyclonal antibody

• 

  WB analysis of HEK-293 using 10702-1-AP

  WB result of VAMP3/Cellubrevin antibody (10702-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-VAMP3/Cellubrevin transfected HEK-293 cells.

• 

  WB analysis of HEK-293 using 10702-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10702-1-AP (VAMP3/Cellubrevin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 10702-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10702-1-AP (VAMP3/Cellubrevin antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 10702-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 10702-1-AP (VAMP3/Cellubrevin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 10702-1-AP

  IP result of anti-VAMP3/Cellubrevin (IP:10702-1-AP, 4ug; Detection:10702-1-AP 1:1000) with HEK-293 cells lysate 3000ug.

• 

  IHC staining of mouse testis using 10702-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10702-1-AP (VAMP3/Cellubrevin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 10702-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10702-1-AP (VAMP3/Cellubrevin antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 10702-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10702-1-AP (VAMP3/Cellubrevin antibody at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

VAMP3/Cellubrevin Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 10702-1-AP

Publications(20)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA, Blocking

Synonyms

VAMP3, CEB, Cellubrevin, SYB3, Synaptobrevin-3

---

Tested Applications

• Positive WB detected in: HEK-293 cells, MCF-7 cells, mouse brain tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: mouse testis tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 16 publications below
• IHC: See 2 publications below
• IF: See 8 publications below

Product Information

10702-1-AP targets VAMP3/Cellubrevin in WB, IHC, IF, IP, ELISA, Blocking applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1156

  Product name: Recombinant human VAMP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-99 aa of BC005941

  Sequence: MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCEMWAIGITVLVIFIIIIIVWVVS

• Full Name: vesicle-associated membrane protein 3 (cellubrevin)
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11-17 kDa
• GenBank Accession Number: BC005941
• Gene Symbol: VAMP3
• Gene ID (NCBI): 9341
• RRID: AB_2212628
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15836
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VAMP3, also named as cellubrevin or synaptobrevin 3, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. VAMP3 is a v-SNARE (soluble NSF-attachment protein receptor). Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP3 resides in recycling endosomes and endosome-derived transport vesicles, involved in regulating membrane traffic. It is implicated in recycling of transferrin receptors, secretion of alpha-granules in platelets, and membrane trafficking during cell migration.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	Blocking	Adv Sci (Weinh); Engineered Cell-Derived Microparticles Bi2Se3/DOX@MPs for Imaging Guided Synergistic Photothermal/Low-Dose Chemotherapy of Cancer.; Authors - Dongdong Wang
human	WB,IF	Adv Sci (Weinh); Early Endosomes Act as Local Exocytosis Hubs to Repair Endothelial Membrane Damage; Authors - Nikita Raj
human	WB,IF	Nat Commun; KRAS regulation by small non-coding RNAs and SNARE proteins.; Authors - Yonglu Che
rat	WB,IF	Aging Cell; Knockdown of astrocytic Grin2a aggravates β-amyloid-induced memory and cognitive deficits through regulating nerve growth factor.; Authors - Zunshu Du
human	WB,IF	Oncogene; Syntaxin-6 mediated autophagy confers lenvatinib resistance in hepatocellular carcinoma; Authors - Guo-Pei Zhang
human	IHC	Oncotarget; A novel liver metastasis-correlated protein of pancreatic neuroendocrine neoplasm (PanNEN) discovered by proteomic analysis.; Authors - Mitsuhiro Shimura