Tested Applications
Positive WB detected in | mouse brain tissue, fetal human brain tissue, rat brain tissue |
Positive IHC detected in | mouse brain tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:5000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 20 publications below |
IHC | See 3 publications below |
IF | See 13 publications below |
Product Information
10135-1-AP targets VAMP2 in WB, IHC, IF, ELISA, Blocking applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0179 Product name: Recombinant human VAMP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC002737 Sequence: MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST Predict reactive species |
Full Name | vesicle-associated membrane protein 2 (synaptobrevin 2) |
Calculated Molecular Weight | 13 kDa |
Observed Molecular Weight | 19 kDa |
GenBank Accession Number | BC002737 |
Gene Symbol | VAMP2 |
Gene ID (NCBI) | 6844 |
RRID | AB_2256918 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P63027 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VAMP2 (vesicle-associated membrane protein 2), also named as synaptobrevin 2, is a member of the SNARE (soluble NSF-attachment protein receptor) family proteins. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP2, with a molecular mass of 15-19 kDa, consists of a short N-terminal sequence, a SNARE motif, and a C-terminal transmembrane region. It is required for fast calcium-triggered synaptic vesicle fusion. VAMP2 forms a stable complex with STX1 (syntaxin 1) and SNAP25 (synaptosomal-associated protein 25) during synaptic vesicle fusion (PMID: 16793874). It also forms a distinct complex with synaptophysin. VAMP2 is expressed in nervous system and some non-neuronal tissues, such as skeletal muscle (PMID: 18570252).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for VAMP2 antibody 10135-1-AP | Download protocol |
IHC protocol for VAMP2 antibody 10135-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Neurosci Aerobic glycolysis is the predominant means of glucose metabolism in neuronal somata, which protects against oxidative damage | ||
Adv Sci (Weinh) Engineered Cell-Derived Microparticles Bi2Se3/DOX@MPs for Imaging Guided Synergistic Photothermal/Low-Dose Chemotherapy of Cancer. | ||
Adv Sci (Weinh) Early Endosomes Act as Local Exocytosis Hubs to Repair Endothelial Membrane Damage | ||
Sci Signal A hepatokine derived from the ER protein CREBH promotes triglyceride metabolism by stimulating lipoprotein lipase activity |