UVRAG Polyclonal antibody

• 

  WB analysis of human brain using 19571-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 19571-1-AP (UVRAG antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 19571-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 19571-1-AP (UVRAG antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated Goat Anti-Rabbit IgG(H+L).

UVRAG Polyclonal Antibody for ELISA

Cat No. 19571-1-AP

Publications(4)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

DHTX, p63, UVRAG

---

Published Applications

• WB: See 4 publications below
• IP: See 1 publications below

Product Information

19571-1-AP targets UVRAG in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13765

  Product name: Recombinant human UVRAG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-311 aa of BC064837

  Sequence: MSASASVGGQVPQPPPGPAAALPPGSAARALHVELPSQQRRLRHLRNIAARNIVNRNGHQLLDTYFTLHLCSTEKIYKEFYRSEVIKNSLNPTWRSLDFGIMPDRLDTSVSCFVVKIWGGKENIYQLLIEWKVCLDGLKYLGQQIHARNQNEIIFGLNDGYYGAPFEHKGYSNAQKTILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQKIGKEIEEKLRLTSTSNELKKKSECLQLKILVLQNELERQKKALGREVALLHKQQIALQDKGSAFSAEHLKLQLQKESLNELRKECTAKRELFLKTN

• Full Name: UV radiation resistance associated gene
• Calculated Molecular Weight: 699 aa, 78 kDa
• GenBank Accession Number: BC064837
• Gene Symbol: UVRAG
• Gene ID (NCBI): 7405
• RRID: AB_10640523
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2Y5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Autophagy; STYK1 promotes autophagy through enhancing the assembly of autophagy-specific class III phosphatidylinositol 3-kinase complex I.; Authors - Cefan Zhou
rat	WB	Sci Rep; High-fat and high-cholesterol diet decreases phosphorylated inositol-requiring kinase-1 and inhibits autophagy process in rat liver.; Authors - Hisao Naito
human	WB	J Exp Clin Cancer Res; Estrogen receptor β inhibits breast cancer cells migration and invasion through CLDN6-mediated autophagy.; Authors - Peiye Song
human	WB,IP	Am J Physiol Cell Physiol; Disrupted APOL1-miR193a Axis Dedifferentiates Podocytes through Autophagy Blockade in APOL1 Risk Milieu.; Authors - Vinod Kumar

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Charlotte (Verified Customer) (01-23-2018)

• Applications: Immunofluorescence,
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: U2OS

UVRAG Antibody Immunofluorescence, validation (1:100 dilution) in U2OS (Cat no:19571-1-AP)