TRUB2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRUB2 Polyclonal antibody (19891-1-AP)

• Featured Product
• KD/KO Validated

TRUB2 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 19891-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

CLONE24922, EC:5.4.99.-, EC:5.4.99.25, Pseudouridylate synthase TRUB2, mitochondrial, Psi55 synthase TRUB2

• 

  WB analysis using 19891-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19891-1-AP (TRUB2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 19891-1-AP

  WB result of TRUB2 antibody (19891-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TRUB2 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 19891-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 19891-1-AP (TRUB2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 19891-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 19891-1-AP (TRUB2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 19891-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TRUB2 antibody (19891-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TRUB2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HT-1080 cells, HeLa cells, HepG2 cells, K-562 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19891-1-AP targets TRUB2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13726

  Product name: Recombinant human TRUB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-331 aa of BC001457

  Sequence: MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRVRFLLGPMEGSEEKELTLTATSVPSFINHPLVCGPAFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQVRRTRDGFFTLDSALLRTQWDLTNIQDAIRAATPQVAAELEKSLSPGLDTKQLPSPGWSWDSQGPSSTLGLERGAGQ

• Full Name: TruB pseudouridine (psi) synthase homolog 2 (E. coli)
• Calculated Molecular Weight: 331 aa, 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC001457
• Gene Symbol: TRUB2
• Gene ID (NCBI): 26995
• RRID: AB_10640900
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95900
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TRUB2 polyclonal antibody (Cat# 19891-1-AP) has 4 total citations. These appear in Nature Cell Biology (2 papers), EMBO Reports, and Scientific Reports. The associated research fields include mitochondrial metabolism and mtDNA expression, tRNA pseudouridine modification, pseudouridine synthase function in mitochondrial protein synthesis, and m6A RNA methylation in hepatic steatosis. All cited applications are Western blot in human samples.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; A comprehensive tRNA pseudouridine map uncovers targets dependent on human stand-alone pseudouridine synthases.; Authors - Haiqi Xu ; KD Validated
human	WB	Nat Cell Biol; Regulators of mitonuclear balance link mitochondrial metabolism to mtDNA expression; Authors - Nicholas J Kramer
human	WB	EMBO Rep; A pseudouridine synthase module is essential for mitochondrial protein synthesis and cell viability.; Authors - Hana Antonicka
human	WB	Sci Rep; Profiling of RNA N6-Methyladenosine methylation reveals the critical role of m6A in betaine alleviating hepatic steatosis; Authors - Yuna Wu