TRIM15 Polyclonal antibody

• 

  WB analysis of Jurkat using 13623-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13623-1-AP (TRIM15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 13623-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13623-1-AP (TRIM15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 13623-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13623-1-AP (TRIM15 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 13623-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13623-1-AP (TRIM15 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

TRIM15 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13623-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, ELISA, IF

Synonyms

RING finger protein 93, RNF93, TRIM15, tripartite motif containing 15, Zinc finger protein 178, Zinc finger protein B7, ZNF178, ZNFB7

---

Tested Applications

• Positive WB detected in: Jurkat cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 4 publications below
• IHC: See 2 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

13623-1-AP targets TRIM15 in WB, IHC, IP, ELISA, IF applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4533

  Product name: Recombinant human TRIM15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-270 aa of BC038585

  Sequence: MPATPSLKVVHELPACTLCAGPLEDAVTIPCGHTFCRLCLPALSQMGAQSSGKILLCPLCQEEEQAETPMAPVPLGPLGETYCEEHGEKIYFFCENDAEFLCVFCREGPTHQAHTVGFLDEAIQPYRDRLRSRLEALSTERDEIEDVKCQEDQKLQVLLTQIESKKHQVETAFERLQQELEQQRCLLLARLRELEQQIWKERDEYITKVSEEVTRLGAQVKELEEKCQQPASELLQDVRVNQSRCEMKTFVSPEAISPDLVKKIRDFHRK

• Full Name: tripartite motif-containing 15
• Calculated Molecular Weight: 465 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC038585
• Gene Symbol: TRIM15
• Gene ID (NCBI): 89870
• RRID: AB_2303892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C019
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRIM15 (Tripartite motif-containing protein 15) is also named as RNF93, ZNF178, ZNFB7 and belongs to the TRIM/RBCC family. It acts as an ubiquitin-protein ligase and contributes to the endogenous restriction of retroviruses in cells.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; TRIM15 and CYLD regulate ERK activation via lysine-63-linked polyubiquitination.; Authors - Guixin Zhu ; KO Validated
human	WB,IP,IF	Biochim Biophys Acta Mol Basis Dis; Ubiquitin ligase TRIM15 promotes the progression of pancreatic cancer via the upregulation of the IGF2BP2-TLR4 axis; Authors - Hongkun Cai
human	IF	J Cell Sci; TRIM15 is a focal adhesion protein that regulates focal adhesion disassembly.; Authors - Pradeep D Uchil ; KD Validated
human	IHC	iScience; Whole-genome DNA methylation and DNA methylation-based biomarkers in lung squamous cell carcinoma; Authors - Qidong Cai
human	WB	J Virol; TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.; Authors - Uchil Pradeep D PD ; KD Validated
human	IHC	J Cancer; Tripartite motif-containing 15 overexpression in non-small cell lung cancer is associated with poor patient prognoses.; Authors - Xiaoying Han