Use Able AI chat for product recommendations

TREM2 Recombinant monoclonal antibody

TREM2 Uni-rAb® Recombinant Antibody for WB, ELISA

Cat No. 83438-6-RR
Clone No. 240384B7
Publications (5)
Reviews (2)
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

240384B7, TREM 2, TREM-2, Trem2a, Trem2b

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for TREM2 in ?

Tested Applications

Positive WB detected inPMA treated THP-1 cells, THP-1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83438-6-RR targets TREM2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0747

Product name: Recombinant human TREM2 protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 19-174 aa of BC032362

Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRPSQGSHLPSCLSK

Predict reactive species
Full Name triggering receptor expressed on myeloid cells 2
Calculated Molecular Weight 222 aa, 25 kDa
Observed Molecular Weight26-32 kDa
GenBank Accession NumberBC032362
Gene Symbol TREM2
Gene ID (NCBI) 54209
RRIDAB_3671079
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ9NZC2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TREM2 (triggering receptor expressed on myeloid cells 2) is a cell surface receptor belongs to TREM family that is expressed on osteoclast, dendritic cells, macrophages, nature killers, neutrophils and microglia (PMID: 19302484). TREM2 is localized predominantly in the Golgi complex, but also shuttles to and from the cell surface in endocytic and exocytic vesicles (PMID: 16675145). TREM2 associates with DAP12 to initiate the intracellular signalling cascade via an immunoreceptor tyrosine-based activation motif (ITAM) domain and tyrosine-kinases (PMID: 23977213).

Protocols

Product Specific Protocols
WB protocol for TREM2 antibody 83438-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Rabbit Recombinant anti-TREM2 (Cat# 83438-6-RR) has 5 citations across journals including ACS Nano, Advanced Science, Free Radical Biology and Medicine, Life Sciences, and ACS Infectious Diseases. Research fields span Alzheimer's disease/neuroscience, prostate cancer immunology, sepsis-induced lung injury and ferroptosis, circadian rhythm-related periodontitis, and mycobacteria-host interactions in infectious disease.

SpeciesApplicationTitle
mouseWB

ACS Nano

Modulating Amyloid Pathology-Neural Hyperexcitability Crosstalk for Alzheimer's Disease Therapy.

Authors - Ying Wang
humanWB

Adv Sci (Weinh)

Cancer Cell-Intrinsic Cholesterol Induces Lipid-Associated Macrophage Differentiation via SP1 Palmitoylation to Promote Prostate Cancer Progression

Authors - Shirong Peng
mouseWB

Free Radic Biol Med

TREM2 alleviates sepsis-induced acute lung injury by attenuating ferroptosis via the SHP1/STAT3 pathway

Authors - Siyi Wu
mouseWB,IHC,IF

Life Sci

Circadian rhythm disruption aggravates periodontitis via orchestrating TREM2+ macrophage-mediated bone resorption.

Authors - Pei Wu
  • KD Validated
mouseWB

ACS Infect Dis

A Photoactivatable Free Mycolic Acid Probe to Investigate Mycobacteria-Host Interactions

Authors - Kingsley C Agu

Reviews

    4.0 out of 5
Add a review

2 verified customer reviews

What customers say

Users report positive results with this antibody. One reviewer (5/5) used it at 1:5000 dilution for Western Blot on microglia and called it a "great antibody." Another reviewer (3/5) applied it at 1:1000 for Immunofluorescence on cortical organoids derived from iPSC controls. Overall, the antibody performs well for Western Blot, with moderate success in IF applications on organoid samples.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Christin (Verified Customer) (12-22-2025)

Great antibody for western blot!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Microglia

Alicia (Verified Customer) (10-07-2025)

Cortical organoid

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Cortical organoid from iPSC control
Loading...
||
New chat

Able™

正在加载,请稍候...