Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, mouse kidney tissue, rat kidney tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human liver tissue, mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18409-1-AP targets TOMM40 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13065 Product name: Recombinant human TOMM40 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-361 aa of BC017224 Sequence: MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG Predict reactive species |
| Full Name | translocase of outer mitochondrial membrane 40 homolog (yeast) |
| Calculated Molecular Weight | 38 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC017224 |
| Gene Symbol | TOMM40 |
| Gene ID (NCBI) | 10452 |
| RRID | AB_2303725 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O96008 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The translocase of outer mitochondria membrane 40 (TOMM40, also known as TOM40), located in the center of the TOM complex, is a channel-forming subunit of translocase. It can facilitate the fluid movement of preproteins into the mitochondria by associating with TOMM20. TOMM40 plays a role in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by forming a complex with BCAP31 and mediating the translocation of Complex I components from the cytosol to the mitochondria (PMID: 31206022). TOMM40 has been reported to be associated with late-onset neurodegenerative diseases such as Alzheimer's disease and Parkinson's disease.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TOMM40 antibody 18409-1-AP | Download protocol |
| IF protocol for TOMM40 antibody 18409-1-AP | Download protocol |
| IHC protocol for TOMM40 antibody 18409-1-AP | Download protocol |
| IP protocol for TOMM40 antibody 18409-1-AP | Download protocol |
| WB protocol for TOMM40 antibody 18409-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-TOMM40 (Cat# 18409-1-AP) has accumulated 154 citations across journals including Nature, Cell, Nature Communications, Molecular Cell, Cell Reports, EMBO Journal, Journal of Clinical Investigation, Autophagy, and Neuron, among many others. Research fields span mitochondrial biology (mitophagy, dynamics, protein import), neurodegeneration (Alzheimer's, Parkinson's), oncology, metabolism, immunology, liver disease, and infectious disease.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Fructose directly remodels the translocase of the outer membrane to impair oxidative phosphorylation in podocytes | ||
Nature In vivo imaging of mitochondrial membrane potential in non-small-cell lung cancer. | ||
Cell MTFP1 controls mitochondrial fusion to regulate inner membrane quality control and maintain mtDNA levels | ||
Cell Tau interactome maps synaptic and mitochondrial processes associated with neurodegeneration. | ||
Cell PLD3 and PLD4 synthesize S,S-BMP, a key phospholipid enabling lipid degradation in lysosomes. |
Reviews
What customers say
All 8 reviewers rated this antibody 5 stars. Users consistently report strong, specific mitochondrial labeling in immunofluorescence across multiple cell types (fibroblasts, HeLa, Cos7, BJ-hTERT), with low background and clear colocalization with TOMM20. For Western blot, it produces a specific band above 37 kDa at dilutions up to 1:2000. One user also confirmed reliable performance in immunoprecipitation. Overall, reviewers recommend it for assessing mitochondrial morphology and structure.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Shivam (Verified Customer) (01-02-2026) | Less background signal and nice precise staining.
|
Emilie (Verified Customer) (09-24-2025) | I applied it in IF (1:200), and it showed good performance.
|
Manon (Verified Customer) (09-17-2025) | We observed clear mitochondrial labeling with this antibody
|
Yan (Verified Customer) (10-21-2024) | Very good protein signal in BJ-hTERT cells in IF. I would recommend it to assess mitochondrial morphology.
 |
Nuo (Verified Customer) (01-28-2023) | Good antibody for WB with high titer.
 |
Süleyman (Verified Customer) (01-23-2022) | TOMM40 antibody (Green) is used 1:100 dilution (2 hour at RT) and 1:700 of Alexa Fluor 488 secondary antibody (1 hour RT). 4% Paraformaldehyde fixation for 10 min at RT. Permeabilization with 0.3% Triton X for 10-15 minutes at RT. 5% FBS in PBS used for blocking for 1 hour at RT. The image is colocalized with TOMM20 (Red). Blue is DAPI. As you can see there is colocalization with TOMM20 with TOMM40. It is a perfect colocalization. You might also reduce concentration to 1:300 as it was used low power of laser.
 |
Tom (Verified Customer) (03-23-2021) | Cos7 cells fixed in 4% PFA and permeabilized in 0.1% Triton X-100. Cells blocked in 1% BSA in PBS.
 |
Daniela (Verified Customer) (01-08-2020) | Immunoblot of total cell lysate of HeLa cell gives three bands, one specific for human Tom40 above 37 KDa on 15% acrylamide gel, the other two no specific and with much lower intensity. The anti-Tom40 antibody worked very well and specifically when conjugated with magnetic beads for immunoprecipitation.
|
