• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated TNF-alpha Monoclonal antibody

TNF-alpha Monoclonal Antibody for IF/ICC, IF-P
Cat No. CL594-60291
Clone No.7B8A11

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IF/ICC, IF-P

TNF, TNF alpha, TNF-a, Intracellular domain 2, Intracellular domain 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman breast cancer tissue
Positive IF/ICC detected inPMA, LPS and Brefeldin A treated THP-1 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-60291 targets TNF-alpha in IF/ICC, IF-P applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11413

Product name: Recombinant human TNF-a protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-233 aa of BC028148

Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Predict reactive species
Full Name tumor necrosis factor (TNF superfamily, member 2)
Calculated Molecular Weight 233 aa, 26 kDa
GenBank Accession NumberBC028148
Gene Symbol TNF-alpha
Gene ID (NCBI) 7124
ENSEMBL Gene IDENSG00000232810
RRIDAB_2883456
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01375
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. The antibody is conjugated with CL594, Ex/Em 593 nm/614 nm.

Protocols

Product Specific Protocols
IF protocol for CL594 TNF-alpha antibody CL594-60291Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...