ASC/TMS1 Polyclonal antibody

• 

  WB analysis using 10500-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 10500-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 10500-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 10500-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 10500-1-AP (TMS1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 10500-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 10500-1-AP (TMS1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HL-60 using 10500-1-AP

  IP result of anti-ASC/TMS1 (IP:10500-1-AP, 4ug; Detection:10500-1-AP 1:10000) with HL-60 cells lysate 2240 ug.

• 

  IHC staining of human lung cancer using 10500-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 10500-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 10500-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 10500-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10500-1-AP (TMS1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 10500-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed MCF-7 cells using 10500-1-AP (TMS1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

ASC/TMS1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 10500-1-AP

Publications(318)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

PYCARD, hASC, Caspase recruitment domain-containing protein 5, CARD5, ASC

---

Tested Applications

• Positive WB detected in: HL-60 cells, A549 cells, Raji cells, U-937 cells, THP-1 cells
• Positive IP detected in: HL-60 cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 280 publications below
• IHC: See 24 publications below
• IF: See 60 publications below
• IP: See 7 publications below
• ELISA: See 1 publications below
• CoIP: See 4 publications below

Product Information

10500-1-AP targets ASC/TMS1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, pig, canine, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0774

  Product name: Recombinant human TMS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-135 aa of BC004470

  Sequence: MGRARDAILDALENLTAEELKKFKLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS

• Full Name: PYD and CARD domain containing
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 22-25 kDa
• GenBank Accession Number: BC004470
• Gene Symbol: ASC/TMS1
• Gene ID (NCBI): 29108
• RRID: AB_2174862
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULZ3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PYCARD , also known as ASC or TMS1, is a 195 amino acid protein containing an N-terminal Pyrin-like domain (PYD) and an 87 residue C-terminal Caspase-associated recruitment domain (CARD). It promotes caspase-mediated apoptosis which is mediated predominantly through the activation of caspase-9.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Adv Sci (Weinh); A Heparan Sulfate Mimetic RAFT Copolymer Inhibits SARS-CoV-2 Infection and Ameliorates Viral-Induced Inflammation; Authors - Jiaxin Ling
human	WB	Nat Chem Biol; E2-Ub-R74G strategy reveals E2-specific ubiquitin conjugation profiles in live cells; Authors - Siqi Shen
human	WB	Research (Wash D C); Herpetrione, a New Type of PPARα Ligand as a Therapeutic Strategy Against Nonalcoholic Steatohepatitis; Authors - Lang Linghu
	WB	Transl Res; IMM-H004 therapy for permanent focal ischemic cerebral injury via CKLF1/CCR4-mediated NLRP3 inflammasome activation.; Authors - Q D Ai
	WB	Environ Pollut; Disturbance of Mitochondrial Dynamics Led to Spermatogenesis Disorder in Mice Exposed to Polystyrene Micro- and Nanoplastics; Authors - Moxuan Zhao
human	WB,IHC	Cancer Res; Silencing of TMS1/ASC promotes resistance to anoikis in breast epithelial cells.; Authors - Parsons Melissa J MJ ; KD Validated