• Featured Product
  • KD/KO Validated

TMEM41A Polyclonal antibody

TMEM41A Polyclonal Antibody for WB, ELISA
Cat No. 20768-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

2900010K02Rik, TMEM41A, transmembrane protein 41A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, mouse small intestine tissue, rat liver tissue, HepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20768-1-AP targets TMEM41A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14753

Product name: Recombinant human TMEM41A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-80 aa of BC008043

Sequence: MRPLLGLLLVFAGCTFALYLLSTRLPRGRRLGSTEEAGGRSLWFPSDLAELRELSEVLREYRKEHQAYVFLLFCGAYLYK

Predict reactive species
Full Name transmembrane protein 41A
Calculated Molecular Weight 264 aa, 30 kDa
Observed Molecular Weight 26-28 kDa
GenBank Accession NumberBC008043
Gene Symbol TMEM41A
Gene ID (NCBI) 90407
RRIDAB_10693679
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96HV5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
WB protocol for TMEM41A antibody 20768-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

TMEM41B Is a Pan-flavivirus Host Factor.

Authors - H-Heinrich Hoffmann
  • KO Validated
humanWB

J Cell Biol

Genome-wide CRISPR screen identifies TMEM41B as a gene required for autophagosome formation.

Authors - Keigo Morita
  • KD Validated
mouseWB

bioRxiv

TMEM41B is a pan-flavivirus host factor.

Authors - H-Heinrich Hoffmann
  • KO Validated
Loading...
||
New chat Able
正在加载,请稍候...