• Featured Product
  • KD/KO Validated

TMEM173/STING Monoclonal antibody

TMEM173/STING Monoclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 66680-1-Ig
Clone No.1F1E1

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat

Applications

WB, IHC, IF-P, IP, ELISA

STING, NET23, MPYS, MITA, ERIS

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, HSC-T6 cells, HEK-293 cells, THP-1 cells, MOLT-4 cells, Jurkat cells
Positive IHC detected inhuman tonsillitis tissue, human spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66680-1-Ig targets TMEM173/STING in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20363

Product name: Recombinant human TMEM173 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 174-379 aa of BC047779

Sequence: ELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS

Predict reactive species
Full Name transmembrane protein 173
Calculated Molecular Weight 379 aa, 42 kDa
Observed Molecular Weight 37 kDa
GenBank Accession NumberBC047779
Gene Symbol STING
Gene ID (NCBI) 340061
RRIDAB_2882034
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ86WV6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Stimulator of interferon genes (STING, also known as ERIS, MITA and MPYS, and encoded by TMEM173) is a transmembrane adaptor protein that facilitates innate immune signaling (PMID: 18724357). STING is widely expressed in various cell types such as endothelial cells, epithelial cells, T cells, macrophages, and dendritic cells (PMID: 26603901). It is predominantly located in the endoplasmic reticulum (ER). STING functions as a sensor of cytosolic DNA and promotes the production of type I interferons and pro-inflammatory cytokines. STING is a 379 amino acid protein with a calculated molecular weight of 42 kDa. It has been observed at 35-40 kDa (PMID: 27324217; 29632140; 30918080), and 70-80 kDa corresponding to the expected size of a STING dimer (PMID: 25790474; 29491158).

Protocols

Product Specific Protocols
IF protocol for TMEM173/STING antibody 66680-1-IgDownload protocol
IHC protocol for TMEM173/STING antibody 66680-1-IgDownload protocol
WB protocol for TMEM173/STING antibody 66680-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB, IF

Immunity

Golgi apparatus-synthesized sulfated glycosaminoglycans mediate polymerization and activation of the cGAMP sensor STING.

Authors - Run Fang
mouseWB

Cell Death Differ

The DJ1-Nrf2-STING axis mediates the neuroprotective effects of Withaferin A in Parkinson's disease.

Authors - Miao Zhao
  • KO Validated
mouseWB

Cell Death Differ

Inhibition of cGAS-STING by JQ1 alleviates oxidative stress-induced retina inflammation and degeneration.

Authors - Ming Zou
human

J Nanobiotechnology

Platelet hitchhiking vascular-disrupting agents for self-amplified tumor-targeting therapy

Authors - Hongyu Chu
human,mouseIF

Autophagy

Lipotoxicity-induced STING1 activation stimulates MTORC1 and restricts hepatic lipophagy.

Authors - Kunpeng Liu
  • KO Validated
mouseIF

J Neuroinflammation

The BET PROTAC inhibitor dBET6 protects against retinal degeneration and inhibits the cGAS-STING in response to light damage

Authors - Xingfei Zhu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Will (Verified Customer) (04-25-2019)

good antibody, will order again

  • Applications: Western Blot,
Loading...
||
New chat Able
正在加载,请稍候...