Tested Applications
| Positive WB detected in | U2OS cells, HeLa cells, K-562 cells, LNCaP cells, A549 cells, Jurkat cells |
| Positive IP detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 6 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
Product Information
60333-1-Ig targets TMEM106B (1-46aa) in WB, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21448 Product name: Recombinant human TMEM106B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-46 aa of BC033901 Sequence: MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVS Predict reactive species |
| Full Name | transmembrane protein 106B |
| Calculated Molecular Weight | 31 kDa |
| Observed Molecular Weight | ~40 kDa |
| GenBank Accession Number | BC033901 |
| Gene Symbol | TMEM106B |
| Gene ID (NCBI) | 54664 |
| RRID | AB_2881442 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9NUM4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM106B is a genetic risk factor for frontotemporal lobar degeneration with TDP-43 inclusions (FTLD-TDP). Amyotrophic lateral sclerosis (ALS), like FTLD-TDP, is characterized by pathological TDP-43 inclusions. TMEM106B expression in the brain may be linked to mechanisms of disease in FTLD-TDP and risk alleles confer genetic susceptibility by increasing gene expression.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for TMEM106B (1-46aa) antibody 60333-1-Ig | Download protocol |
| WB protocol for TMEM106B (1-46aa) antibody 60333-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Brain C-terminal TMEM106B fragments in human brain correlate with disease-associated TMEM106B haplotypes | ||
Pathol Res Pract TESC acts as a prognostic factor and promotes epithelial-mesenchymal transition progression in esophageal squamous carcinoma | ||
Life Med Tracing TMEM106B fibril deposition in aging and Parkinson's disease with dementia brains | ||
F1000Res The identification of high-performing antibodies for transmembrane protein 106B (TMEM106B) for use in Western blot, immunoprecipitation, and immunofluorescence
| ||
FASEB J Lysosomal membrane protein TMEM106B modulates hematopoietic stem and progenitor cell proliferation and differentiation by regulating LAMP2A stability |









