Tested Applications
| Positive WB detected in | HepG2 cells, Jurkat cells, MCF-7 cells, mouse heart tissue, rat heart tissue |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 149 publications below |
| IHC | See 3 publications below |
| IF | See 16 publications below |
| IP | See 1 publications below |
Product Information
11123-1-AP targets TIM23 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, canine, monkey, bovine, hamster, megalobrama amblycephala |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1620 Product name: Recombinant human Tim23 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-208 aa of BC062707 Sequence: MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFIPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL Predict reactive species |
| Full Name | translocase of inner mitochondrial membrane 23 |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 22 kDa |
| GenBank Accession Number | BC062707 |
| Gene Symbol | TIMM23 |
| Gene ID (NCBI) | 100287932 |
| RRID | AB_615045 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14925 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TIM23 is a mitochondrial inner membrane protein essential for import of preproteins into the matrix. Tim23 together with Tim17 and Tim44 form the Tim23 complex which mediates the import of nuclear encoded preproteins into the mitochondria. Tim23 is commonly used as loading control for mitochondrial inner membrane protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TIM23 antibody 11123-1-AP | Download protocol |
| IHC protocol for TIM23 antibody 11123-1-AP | Download protocol |
| IP protocol for TIM23 antibody 11123-1-AP | Download protocol |
| WB protocol for TIM23 antibody 11123-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nature In vivo imaging of mitochondrial membrane potential in non-small-cell lung cancer. | ||
Signal Transduct Target Ther Targeting CRL4 suppresses chemoresistant ovarian cancer growth by inducing mitophagy | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Zhihao (Verified Customer) (01-30-2026) | It is a really good marker to detect mitochondrial mass and mitophagy.
![]() |
FH Samuel (Verified Customer) (12-16-2025) | I found this TIM23 primary antibody to meet, (in the case of Western blotting), and exceed, (in the case of IHC), my expectations based on the results I was obtaining for this very same protein target using antibodies manufactured by competing brands. For instance, I would experience very faint Western blot banding with a competing antibody at the typical primary antibody concentration I use, (1:1000), and would only receive reasonable band intensity when I would increase my concentration to about 1:500 or so, (which would use up just a bit too much antibody, in my view). Additionally, I would experience a decent amount of non-specific banding, making it a bit more challenging to determine the correct banding pattern for the protein of interest. To reiterate, what I just mentioned was my experience testing this protein by Western using a competing primary antibody - with the Proteintech antibody I was able to dilute my primary antibody concentration to 1:2500 and that was more than sufficient to obtain a clean and intense Western banding pattern, along with practically zero non-specific banding. Lastly, my experience using this Proteintech antibody for my IHC experiment was fantastic - the staining I obtained was very clear and the intensity was to my liking, as well, given the antibody dilution I used. Overall, I rate this antibody very highly and would absolutely recommend it to others who are in need of an antibody targeting this protein.
|
FH Wenhui (Verified Customer) (01-02-2025) | This antibody is good for detecting correct and clear band for WB with cardiac tissues and cardiomyocytes. I would have recommended it.
|
FH Angela (Verified Customer) (12-27-2024) | very good antibody , purchase many times!
![]() |











