Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

TCTN2 Polyclonal antibody

TCTN2 Polyclonal Antibody for IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

C12orf38, TCTN2, TECT2, Tectonic 2, tectonic family member 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for TCTN2 in ?

Tested Applications

Positive IHC detected inhuman colon cancer tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17053-1-AP targets TCTN2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10725

Product name: Recombinant human TCTN2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 351-697 aa of BC009112

Sequence: VIYEEATDLDKFITNTETPLNNGSTPRIVNVEEHYIFKWNNNTISEINVKIFRAEINAHQKGIMTQRFVVKFLSYNSGNEEELSGNPGYQLGKPVRALNINRMNNVTTLHLWQSAGRGLCTSATFKPILFGENVLSGCLLEVGINENCTQLRENAVERLDSLIQATHVAMRGNSDYADLSDGWLEIIRVDAPDPGADPLASSVNGMCLDIPAHLSIRILISDAGAVEGITQQEILGVETRFSSVNWQYQCGLTCEHKADLLPISASVQFIKIPAQLPHPLTRFQINYTEYDCNRNEVCWPQLLYPWTQYYQGELHSQCVAKGLLLLLFLTLALFLSNPWTRICKAYS

Predict reactive species
Full Name tectonic family member 2
Calculated Molecular Weight 697 aa, 77 kDa
GenBank Accession NumberBC009112
Gene Symbol TCTN2
Gene ID (NCBI) 79867
RRIDAB_2202406
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96GX1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TCTN2 (tectonic-2 or TECT2) is a type I membrane protein that belongs to the tectonic family, which consists of TCTN1, TCTN2 and TCTN3. Studies in mice suggest that tectonic may be involved in Hedgehog (Hh) signaling, and essential for ciliogenesis. Tectonic is component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. It exists two spilcing isoforms. The first aberrant transcript introduces 104 base pair from intron 13 and would delete 196 original amino acid, introduce two novel amino acids, and prematurely truncate the 697aa protein at residue number 504. The second transcript lacks exon 14 and would delete 195 original amino acids, introduce four novel amino acids, and prematurely truncate the 697 aa protein at residue number 507. The molecular weight of two isoforms are about 50kDa. We detected the 50kDa and 90kDa protein by immunoprecipitaion, but 50kDa protein may be the splicing isoform or non-specific band.

Protocols

Product Specific Protocols
IHC protocol for TCTN2 antibody 17053-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The TCTN2 Polyclonal antibody (Cat# 17053-1-AP) has 11 citations published in Cell, Nature Genetics, Nature Cell Biology, Nature Communications, Journal of Clinical Investigation, EMBO Journal, Journal of Cell Biology, Journal of Neuroscience, eLife, and bioRxiv. The research fields span ciliogenesis, ciliary transition zone assembly, Hedgehog signaling, Wnt signaling, GPCR ciliary targeting, and mitochondrial protein regulation of primary cilia formation.

SpeciesApplicationTitle
mouseWB

Cell

Mapping the NPHP-JBTS-MKS protein network reveals ciliopathy disease genes and pathways.

Authors - Sang Liyun L
humanWB,IF

Nat Genet

A transition zone complex regulates mammalian ciliogenesis and ciliary membrane composition.

Authors - Garcia-Gonzalo Francesc R FR
humanWB,IF

Nat Cell Biol

CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base.

Authors - Wang Won-Jing WJ
human

Nat Commun

Microtubule asters anchored by FSD1 control axoneme assembly and ciliogenesis.

Authors - Hai-Qing Tu
humanIF

J Clin Invest

Primary cilia formation requires the Leigh syndrome-associated mitochondrial protein NDUFAF2

Authors - Chien-Hui Lo
mouseIF

EMBO J

Cell type-specific regulation of ciliary transition zone assembly in vertebrates.

Authors - Antonia Wiegering

Reviews

    3.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (3/5 stars) used this antibody at 1:100 dilution for immunofluorescence on methanol-fixed mouse NIH3T3 cells. The staining confirmed Tctn2 localization to the centriole in ciliated cells, co-stained with Arl13b (primary cilia marker) and DAPI. However, the reviewer noted noisy background in the cytoplasm, which slightly affected image clarity. Overall, the antibody worked for its intended purpose but could benefit from lower background.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Jay (Verified Customer) (12-02-2019)

Methanol Fixation.Immunostaining result shows that Tctn2 localizes to centriole in ciliated NIH3T3 cell (Tctn2;red, Arl13b;green for primary cilia, DAPI;blue for nucleus).The antibody seems to have noisy background in cytoplasm.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse NIH3T3
TCTN2 Antibody Immunofluorescence, validation (1:100 dilution) in Mouse NIH3T3 (Cat no:17053-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...