Tested Applications
| Positive IHC detected in | human colon cancer tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17053-1-AP targets TCTN2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10725 Product name: Recombinant human TCTN2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 351-697 aa of BC009112 Sequence: VIYEEATDLDKFITNTETPLNNGSTPRIVNVEEHYIFKWNNNTISEINVKIFRAEINAHQKGIMTQRFVVKFLSYNSGNEEELSGNPGYQLGKPVRALNINRMNNVTTLHLWQSAGRGLCTSATFKPILFGENVLSGCLLEVGINENCTQLRENAVERLDSLIQATHVAMRGNSDYADLSDGWLEIIRVDAPDPGADPLASSVNGMCLDIPAHLSIRILISDAGAVEGITQQEILGVETRFSSVNWQYQCGLTCEHKADLLPISASVQFIKIPAQLPHPLTRFQINYTEYDCNRNEVCWPQLLYPWTQYYQGELHSQCVAKGLLLLLFLTLALFLSNPWTRICKAYS Predict reactive species |
| Full Name | tectonic family member 2 |
| Calculated Molecular Weight | 697 aa, 77 kDa |
| GenBank Accession Number | BC009112 |
| Gene Symbol | TCTN2 |
| Gene ID (NCBI) | 79867 |
| RRID | AB_2202406 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96GX1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TCTN2 (tectonic-2 or TECT2) is a type I membrane protein that belongs to the tectonic family, which consists of TCTN1, TCTN2 and TCTN3. Studies in mice suggest that tectonic may be involved in Hedgehog (Hh) signaling, and essential for ciliogenesis. Tectonic is component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. It exists two spilcing isoforms. The first aberrant transcript introduces 104 base pair from intron 13 and would delete 196 original amino acid, introduce two novel amino acids, and prematurely truncate the 697aa protein at residue number 504. The second transcript lacks exon 14 and would delete 195 original amino acids, introduce four novel amino acids, and prematurely truncate the 697 aa protein at residue number 507. The molecular weight of two isoforms are about 50kDa. We detected the 50kDa and 90kDa protein by immunoprecipitaion, but 50kDa protein may be the splicing isoform or non-specific band.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TCTN2 antibody 17053-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TCTN2 Polyclonal antibody (Cat# 17053-1-AP) has 11 citations published in Cell, Nature Genetics, Nature Cell Biology, Nature Communications, Journal of Clinical Investigation, EMBO Journal, Journal of Cell Biology, Journal of Neuroscience, eLife, and bioRxiv. The research fields span ciliogenesis, ciliary transition zone assembly, Hedgehog signaling, Wnt signaling, GPCR ciliary targeting, and mitochondrial protein regulation of primary cilia formation.
| Species | Application | Title |
|---|---|---|
Cell Mapping the NPHP-JBTS-MKS protein network reveals ciliopathy disease genes and pathways. | ||
Nat Genet A transition zone complex regulates mammalian ciliogenesis and ciliary membrane composition. | ||
Nat Cell Biol CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base. | ||
Nat Commun Microtubule asters anchored by FSD1 control axoneme assembly and ciliogenesis. | ||
J Clin Invest Primary cilia formation requires the Leigh syndrome-associated mitochondrial protein NDUFAF2 | ||
Reviews
What customers say
One reviewer (3/5 stars) used this antibody at 1:100 dilution for immunofluorescence on methanol-fixed mouse NIH3T3 cells. The staining confirmed Tctn2 localization to the centriole in ciliated cells, co-stained with Arl13b (primary cilia marker) and DAPI. However, the reviewer noted noisy background in the cytoplasm, which slightly affected image clarity. Overall, the antibody worked for its intended purpose but could benefit from lower background.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jay (Verified Customer) (12-02-2019) | Methanol Fixation.Immunostaining result shows that Tctn2 localizes to centriole in ciliated NIH3T3 cell (Tctn2;red, Arl13b;green for primary cilia, DAPI;blue for nucleus).The antibody seems to have noisy background in cytoplasm.
![]() |








