TCF3 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• TCF3 Monoclonal antibody (67140-1-Ig)

• Featured Product
• KD/KO Validated

TCF3 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67140-1-Ig

Clone No.1D12E5

Publications(7)

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

E2A, 1D12E5, bHLHb21, Class B basic helix-loop-helix protein 21, E47

• 

  WB analysis using 67140-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67140-1-Ig (TCF3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 67140-1-Ig

  WB result of TCF3 antibody (67140-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TCF3 transfected Jurkat cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NCI-H1299 using 67140-1-Ig

  NCI-H1299 cells were subjected to SDS PAGE followed by western blot with 67140-1-Ig (TCF3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 67140-1-Ig

  PC-3 cells were subjected to SDS PAGE followed by western blot with 67140-1-Ig (TCF3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 67140-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67140-1-Ig (TCF3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 67140-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 67140-1-Ig (TCF3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 67140-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TCF3 antibody (67140-1-Ig, Clone: 1D12E5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 67140-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 67140-1-Ig (TCF3 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HepG2 cells, Jurkat cells, K-562 cells, NCI-H1299 cells, PC-3 cells, A549 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67140-1-Ig targets TCF3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15734

  Product name: Recombinant human TCF3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 318-480 aa of BC110580

  Sequence: WPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTRCQ

• Full Name: transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
• Calculated Molecular Weight: 654 aa, 68 kDa
• Observed Molecular Weight: 68-70 kDa
• GenBank Accession Number: BC110580
• Gene Symbol: TCF3
• Gene ID (NCBI): 6929
• RRID: AB_2882439
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15923
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Reproduction; TCF3 regulates human endometrial stromal cell proliferation and migration in RPL.; Authors - Xiao-Wei Wei ; KD Validated
human	WB,IHC	Mol Med Rep; Expression of TCF3 in Wilms' tumor and its regulatory role in kidney tumor cell viability, migration and apoptosis in vitro.; Authors - Nian Zhou ; KD Validated
human	WB	J Exp Clin Cancer Res; TCF3 activates super-enhancer-driven TRIB2 overexpression to suppress ferroptosis and promote hepatoblastoma proliferation.; Authors - Han Wu
human	IHC	Clin Transl Oncol; miR-138-5p inhibits WiT-49 cell growth in vitro by downregulating TCF3 expression, and suppresses tumorigenesis in vivo.; Authors - Zhigang Yao
	IHC	Cell Death Discov; TRIM21 promotes colorectal cancer development through regulating DNA replication by TCF3/MCM2/5 axis; Authors - Xintian Zhang
human	WB	Cancer Med; Palladin promotes cancer stem cell-like properties in lung cancer by activating Wnt/Β-Catenin signaling; Authors - Xiong Shu