TCF3 Polyclonal antibody

• 

  WB analysis of Jurkat using 21242-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 21242-1-AP (E2A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 21242-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21242-1-AP (E2A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 21242-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 21242-1-AP (E2A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 21242-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 21242-1-AP (E2A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 21242-1-AP

  IP result of anti-TCF3 (IP:21242-1-AP, 4ug; Detection:21242-1-AP 1:500) with Jurkat cells lysate 2800ug.

• 

  IF Staining of HeLa using 21242-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using TCF3 antibody (21242-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

TCF3 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 21242-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, CoIP, ELISA

Synonyms

E2A, ITF1, Immunoglobulin enhancer-binding factor E12/E47, E47, Class B basic helix-loop-helix protein 21

---

Tested Applications

• Positive WB detected in: Jurkat cells, PC-3 cells, K-562 cells, NIH/3T3 cells
• Positive IP detected in: Jurkat cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IF: See 1 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

21242-1-AP targets TCF3 in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15734

  Product name: Recombinant human TCF3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 318-480 aa of BC110580

  Sequence: WPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTRCQ

• Full Name: transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
• Calculated Molecular Weight: 654 aa, 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC110580
• Gene Symbol: TCF3
• Gene ID (NCBI): 6929
• RRID: AB_10755295
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P15923
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nat Cell Biol; Mapping putative enhancers in mouse oocytes and early embryos reveals TCF3/12 as key folliculogenesis regulators; Authors - Bofeng Liu
human	WB,CoIP	Cell Signal; Targeting SDCBP2 in acute myeloid leukemia; Authors - Yan Du
human	WB	J Cell Mol Med; The role of E2A in ATPR-induced cell differentiation and cycle arrest in acute myeloid leukaemia cells.; Authors - Meiju Zhang ; KD Validated
mouse	WB	Mol Immunol; Ablation of core fucosylation attenuates the signal transduction via T cell receptor to suppress the T cell development.; Authors - Wei Liang
rat	IP	Life Sci; miR-27a promotes endothelial-mesenchymal transition in hypoxia-induced pulmonary arterial hypertension by suppressing BMP signaling.; Authors - Ting Liu
mouse	WB	Nat Commun; A p38α-BLIMP1 signalling pathway is essential for plasma cell differentiation; Authors - Jianfeng Wu