Tested Applications
| Positive WB detected in | HL-60 cells, mouse skeletal muscle tissue, HEK-293 cells, HeLa cells, K-562 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10779-1-AP targets TCEB2/Elongin-B in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1228 Product name: Recombinant human TCEB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC013306 Sequence: MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ Predict reactive species |
| Full Name | transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 18 kDa |
| GenBank Accession Number | BC013306 |
| Gene Symbol | TCEB2 |
| Gene ID (NCBI) | 6923 |
| RRID | AB_2240375 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15370 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TCEB2 encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex and is also reported to function as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes (PMID: 26531153). TCEB2 has 2 isoforms with the molecular mass of 13 and 18 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TCEB2/Elongin-B antibody 10779-1-AP | Download protocol |
| IP protocol for TCEB2/Elongin-B antibody 10779-1-AP | Download protocol |
| WB protocol for TCEB2/Elongin-B antibody 10779-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TCEB2/Elongin-B Polyclonal antibody (Cat# 10779-1-AP) has 8 total citations. These appear in Nature, Cell, Cell Death & Differentiation, PNAS, Cell Signaling, and bioRxiv. Research fields span cysteine catabolism, tau proteostasis and neurodegeneration, colorectal cancer stemness and chemoresistance, ferroptosis regulation, herpesvirus pathogenesis, and ubiquitin-proteasome-mediated protein degradation.
| Species | Application | Title |
|---|---|---|
Cell Death Differ USP51 facilitates colorectal cancer stemness and chemoresistance by forming a positive feed-forward loop with HIF1A | ||
Cell Death Differ CRL2-KLHDC3 E3 ubiquitin ligase complex suppresses ferroptosis through promoting p14ARF degradation. | ||
Proc Natl Acad Sci U S A The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation | ||
Cell Signal pVHL interacts with Ceramide kinase like (CERKL) protein and ubiquitinates it for oxygen dependent proteasomal degradation. |
Reviews
What customers say
Both reviewers gave 5 stars for Western Blot on HEK293T cells using a 1:500 dilution (lot 00001072). One user noted that while bands can appear somewhat diffuse, they are highly specific with no background or off-target signals, calling it the best EloB antibody their lab has tried. The other reported a strong, clean signal when blocking with 5% NFM or 5% BSA in TBST. Overall, users praise its specificity and reliable performance for WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Anna (Verified Customer) (02-05-2026) | Bands tend to be diffuse but are specific (no background or off-target bands). The best EloB antibody I or anyone in our lab has tried.
|
Abigail (Verified Customer) (12-16-2025) | Strong, clean signal with 5% NFM or 5% BSA in TBST at 1:500
|
