TCEB1 Polyclonal antibody

• 

  WB analysis using 12450-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12450-1-AP (TCEB1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 12450-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12450-1-AP (TCEB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 12450-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 12450-1-AP (TCEB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 12450-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 12450-1-AP (TCEB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 12450-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12450-1-AP (TCEB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 12450-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using TCEB1 antibody (12450-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

TCEB1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12450-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

SIII p15, Elongin-C, Elongin C, Elongin 15 kDa subunit, EloC

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, mouse testis tissue, rat testis tissue
• Positive IHC detected in: human breast cancer tissue, human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

12450-1-AP targets TCEB1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3087

  Product name: Recombinant human TCEB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-112 aa of BC013809

  Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

• Full Name: transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C)
• Calculated Molecular Weight: 112 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC013809
• Gene Symbol: TCEB1
• Gene ID (NCBI): 6921
• RRID: AB_2201139
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15369
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TCEB1, also named as RNA polymerase II transcription factor SIII subunit C, belongs to the SKP1 family. It mediates the ubiquitination of ECS-E3 ubiquitin-protein ligase complexes. TCEB1 is overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3. TCEB1 also promotes invasion of prostate cancer cells (PMID:18844214).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Proc Natl Acad Sci U S A; The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation; Authors - Magda Wąchalska
human	WB	Cell Death Differ; CRL2-KLHDC3 E3 ubiquitin ligase complex suppresses ferroptosis through promoting p14ARF degradation.; Authors - Pingzhao Zhang
human	IHC	Am J Pathol; A 12-gene expression signature is associated with aggressive histological in prostate cancer: SEC14L1 and TCEB1 genes are potential markers of progression.; Authors - Agell Laia L
rat	WB	Evid Based Complement Alternat Med; Antiosteoporotic Effects of Huangqi Sanxian Decoction in Cultured Rat Osteoblasts by Proteomic Characterization of the Target and Mechanism.; Authors - Chong-Chong Guo
human	WB	bioRxiv; The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation; Authors - Magda Wąchalska
human	WB	bioRxiv; Allosteric degraders induce CRL5 ASB8 mediated degradation of XPO1; Authors - Casey Elizabeth Hudman-Wing