Neurokinin-1 receptor Polyclonal antibody

• 

  WB analysis using 17942-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17942-1-AP (Neurokinin-1 receptor antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 17942-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 17942-1-AP (Neurokinin-1 receptor antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of THP-1 using 17942-1-AP

  THP-1 cells were subjected to SDS PAGE followed by western blot with 17942-1-AP (Neurokinin-1 receptor antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 17942-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 17942-1-AP (Neurokinin-1 receptor antibody at dilution of 1:300 incubated at 4 degree celsius over night.

Neurokinin-1 receptor Polyclonal Antibody for WB, ELISA

Cat No. 17942-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Neurokinin-1 receptor, NK 1 receptor, NK 1R, NK1R, NK-1R, NKIR, SPR, Substance P receptor, TAC1R, tachykinin receptor 1, TACR1

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, THP-1 cells, mouse pancreas tissue, Caco-2 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 7 publications below

Product Information

17942-1-AP targets Neurokinin-1 receptor in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12368

  Product name: Recombinant human TACR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 304-407 aa of BC074911

  Sequence: IYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS

• Full Name: tachykinin receptor 1
• Calculated Molecular Weight: 407 aa, 46 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: BC074911
• Gene Symbol: Neurokinin-1 receptor
• Gene ID (NCBI): 6869
• RRID: AB_2200611
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P25103
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

neurokinin 1 receptor (NK1R, also known as the tachykinin 1 receptor, TACR1), a mediator of behavioral stress responses, in alcohol dependence and treatment. One such neurotransmitter is substance P (SP), which together with its preferred TACR1 is highly expressed in brain areas involved in stress responses and drug reward, including the hypothalamus, amygdala, and nucleus accumbens (PMID: 18276852).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Phytomedicine; Differential effect of polysaccharide and nonpolysaccharide components in Sijunzi decoction on spleen deficiency syndrome and their mechanisms.; Authors - Ping Ma
mouse	WB	PLoS One; Hemokinin-1(4-11)-Induced Analgesia Selectively Up-Regulates δ-Opioid Receptor Expression in Mice.; Authors - Cai-Yun Fu
mouse	WB	J Neuroimmunol; Tropisetron attenuates lipopolysaccharide induced neuroinflammation by inhibiting NF-κB and SP/NK1R signaling pathway.; Authors - Yan Yu
mouse	WB	Peptides; Study on the distribution sites and the molecular mechanism of analgesia after intracerebroventricular injection of rat/mouse hemokinin-1 in mice.; Authors - Xia Rui-Long RL
human	WB	Neoplasma; miR-877-5p antagonizes the promoting effect of SP on the gastric cancer progression.; Authors - Xiao-Dan Guo
human	WB	Pharm Biol; Stigmasterol alleviates allergic airway inflammation and airway hyperresponsiveness in asthma mice through inhibiting substance-P receptor; Authors - Jimei Zhang