SUCLA2 Polyclonal antibody

• 

  WB analysis of HEK-293 using 12627-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12627-1-AP (SUCLA2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 12627-1-AP

  WB result of SUCLA2 antibody (12627-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SUCLA2 transfected HepG2 cells.

• 

  WB analysis of L02 using 12627-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 12627-1-AP (SUCLA2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 12627-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 12627-1-AP (SUCLA2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 12627-1-AP

  IP result of anti-SUCLA2 (IP:12627-1-AP, 4ug; Detection:12627-1-AP 1:1000) with HEK-293 cells lysate 2800ug.

• 

  IHC staining of human colon cancer using 12627-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12627-1-AP (SUCLA2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 12627-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12627-1-AP (SUCLA2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 12627-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 12627-1-AP (SUCLA2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 12627-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 12627-1-AP (SUCLA2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human kidney using 12627-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 12627-1-AP (SUCLA2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 12627-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 12627-1-AP (SUCLA2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human colon cancer using 12627-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12627-1-AP (SUCLA2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 12627-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12627-1-AP (SUCLA2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 12627-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SUCLA2 antibody (12627-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

SUCLA2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12627-1-AP

Publications(23)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

SCS-betaA, SCS betaA, EC:6.2.1.5, ATP-specific succinyl-CoA synthetase subunit beta, A-SCS

---

Tested Applications

• Positive WB detected in: HEK-293 cells, L02 cells, SH-SY5Y cells, HepG2 cells, PC-3 cells, mouse brain tissue, mouse liver tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human colon cancer tissue, human heart tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 18 publications below
• IHC: See 4 publications below
• IF: See 3 publications below

Product Information

12627-1-AP targets SUCLA2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3319

  Product name: Recombinant human SUCLA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-353 aa of BC027587

  Sequence: AQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMELLQEAGVSVPKGYVAKSPDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGPVLIGSSHGGVNIEDVAAESPEAIIKEPIDIEEGIKKEQALQLAQKMGFPPNIVESAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDERDKDAAKANLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGAT

• Full Name: succinate-CoA ligase, ADP-forming, beta subunit
• Calculated Molecular Weight: 463 aa, 50 kDa
• Observed Molecular Weight: 48-50 kDa
• GenBank Accession Number: BC027587
• Gene Symbol: SUCLA2
• Gene ID (NCBI): 8803
• RRID: AB_2271200
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2R7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SUCLA2, β subunit of succinate-CoA ligase, contributes to energy production in mitochondria through the succinate-CoA ligase enzyme. Succinate-CoA ligase catalyses the reversible conversion of succinyl-CoA and ADP or GDP to succinate and ATP or GTP. SUCLA2 mutations cause global protein succinylation and mitochondrial DNA depletion (PMID: 33230181, PMID: 20301762). Mutations in SUCLA2 are also associated with SUCLA2-related mitochondrial DNA depletion syndrome, leigh syndrome, down syndrome (PMID: 23010432).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Quantitative subcellular acyl-CoA analysis reveals distinct nuclear metabolism and isoleucine-dependent histone propionylation; Authors - Sophie Trefely
human	WB	Adv Sci (Weinh); SUCLG2 Regulates Mitochondrial Dysfunction through Succinylation in Lung Adenocarcinoma; Authors - Qifan Hu
human	WB	Nat Commun; Low chorionic villous succinate accumulation associates with recurrent spontaneous abortion risk.; Authors - Xiao-Hui Wang
mouse	WB	Aging Dis; Dietary Salt Disrupts Tricarboxylic Acid Cycle and Induces Tau Hyperphosphorylation and Synapse Dysfunction during Aging; Authors - Minghao Yuan
human,mouse	WB,IHC	Oncogene; MUC1 triggers lineage plasticity of Her2 positive mammary tumors; Authors - Zhi Pang
human	WB,IHC	Oncogene; Pharmacologically targetable vulnerability in prostate cancer carrying RB1-SUCLA2 deletion.; Authors - Susumu Kohno ; KO Validated