Use Able AI chat for product recommendations

STAT5A Monoclonal antibody

STAT5A Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66459-1-Ig
Clone No. 1F10F6
Publications (4)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, CoIP, ELISA

1F10F6, MGF, STAT5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for STAT5A in ?

Tested Applications

Positive WB detected inRAW 264.7 cells, U-937 cells, rat spleen tissue, pig spleen tissue
Positive IHC detected inhuman lymphoma tissue, human urothelial carcinoma tissue, mouse brown adipose tissue, mouse testis tissue, rat adrenal gland tissue, rat brown adipose tissue, rat testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66459-1-Ig targets STAT5A in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19546

Product name: Recombinant human STAT5A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 445-794 aa of BC027036

Sequence: ESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS

Predict reactive species
Full Name signal transducer and activator of transcription 5A
Calculated Molecular Weight 794 aa, 92 kDa
Observed Molecular Weight 95 kDa
GenBank Accession NumberBC027036
Gene Symbol STAT5A
Gene ID (NCBI) 6776
RRIDAB_2881828
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP42229
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STAT5A, also named as STAT5, belongs to the transcription factor STAT family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT5A is activated by, and mediates the responses of many cell ligands, such as IL2, IL3, IL7 GM-CSF, erythropoietin, thrombopoietin, and different GHs. Activation of STAT5A in myeloma and lymphoma associated with a TEL/JAK2 gene fusion is independent of cell stimulus and has been shown to be essential for the tumorigenesis. The mouse counterpart of human STAT5A is found to induce the expression of BCL2L1/BCL-X(L), which suggests the antiapoptotic function of STAT5A in cells.

Protocols

Product Specific Protocols
IF protocol for STAT5A antibody 66459-1-IgDownload protocol
IHC protocol for STAT5A antibody 66459-1-IgDownload protocol
WB protocol for STAT5A antibody 66459-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The STAT5A Monoclonal antibody (1F10F6), catalog number 66459-1-Ig, has 4 citations published in J Clin Invest, J Med Chem, J Agric Food Chem, and Acta Biochim Biophys Sin (Shanghai). The associated research fields include tumor immunology (CD8+ T cell anti-tumor activity), ischemic stroke pharmacology, gut microbiota-related colitis via the JAK-STAT pathway, and hyperglycemia-induced vascular injury involving p53-mediated ROS accumulation.

SpeciesApplicationTitle
humanWB

J Clin Invest

Intrinsic RIG-I restrains STAT5 activation to modulate anti-tumor activity of CD8+ T cells

Authors - Xinyi Jiang
humanWB

J Med Chem

Discovery of a Natural Small-Molecule Inhibitor to Novel Target STAT5A for Ischemic Stroke Therapy.

Authors - Jiping Liao
mouseWB

J Agric Food Chem

Dietary Glyphosate at the Regulatory "Safe" Level Worsens Colitis via a Gut Microbiota-Derived Palmitic Acid-JAK-STAT Pathway.

Authors - Jing-Bo Liu
humanWB,IF,CoIP

Acta Biochim Biophys Sin (Shanghai)

ZIPK collaborates with STAT5A in p53-mediated ROS accumulation in hyperglycemia-induced vascular injury

Authors - Qichao Wu
  • KD Validated
Loading...
||
New chat

Able™

正在加载,请稍候...