STAT4 Polyclonal antibody

• 

  WB analysis using 13028-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13028-1-AP (STAT4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 13028-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13028-1-AP (STAT4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 13028-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13028-1-AP (STAT4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 13028-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 13028-1-AP (STAT4 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human testis using 13028-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 13028-1-AP (STAT4 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IF Staining of HeLa using 13028-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using STAT4 antibody (13028-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

STAT4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13028-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

DPMC, SLEB11

---

Tested Applications

• Positive WB detected in: A549 cells, Jurkat cells, mouse lung tissue, HeLa cells, PC-3 cells, rat lung tissue
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 9 publications below
• IHC: See 4 publications below
• IF: See 1 publications below

Product Information

13028-1-AP targets STAT4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3660

  Product name: Recombinant human STAT4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 399-748 aa of BC031212

  Sequence: FRHLQPKEMKSSAGGKGNEGCHMVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNLVFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCKEHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE

• Full Name: signal transducer and activator of transcription 4
• Calculated Molecular Weight: 748 aa, 86 kDa
• Observed Molecular Weight: 86 kDa
• GenBank Accession Number: BC031212
• Gene Symbol: STAT4
• Gene ID (NCBI): 6775
• RRID: AB_2196604
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14765
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The JAK/STAT pathway is an extensive signaling pathway downstream of cytokine receptors. STATs are cytosolic proteins with a common structure consisting of an N-terminal oligomerization domain, which favors formation of STAT dimers, followed by a DNA-binding domain and a C-terminal SRC homology-2 (SH2) domain, which is involved in association between STATs and receptors[PMID:22383755]. Signal Transducer and Activator of Transcription 4 (STAT4) is a transcription factor that is activated by IL-12 signaling and promotes Th1-cell differentiation and IFN-γ production [PMID:21998209].

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Nature; Divergent transcriptional regulation of astrocyte reactivity across disorders.; Authors - Joshua E Burda
human	WB	Front Immunol; Native CGRP Neuropeptide and Its Stable Analogue SAX, But Not CGRP Peptide Fragments, Inhibit Mucosal HIV-1 Transmission.; Authors - Jammy Mariotton
rat,human	WB	Food Chem Toxicol; HDAC inhibitor HPTA initiates anti-tumor response by CXCL9/10-recruited CXCR3+CD4+T cells against PAHs carcinogenicity; Authors - Chen Chen
human	WB	Biosci Rep; Identification and validation of STAT4 as a prognostic biomarker in acute myeloid leukemia; Authors - Chenyu Li ; KD Validated
rat	WB	Iran J Basic Med Sci; Quercetin of huoxuehuayu tongluo decoction and azithromycin combination therapy effectively improves rat tubal factor infertility by inhibiting inflammation; Authors - Liang Shao
human	WB	Acta Pharmacol Sin; Bardoxolone displays potent activity against triple negative breast cancer by inhibiting the TRIP13/STAT3 circuit; Authors - Jun-Hao Deng